SecReT6
Protein ID: 333898450
SecReT6 ID439
T6SS typei3
Gene symbol-
Locus tagPsefu_0245
StrainPseudomonas fulva 12-X
Repliconchromosome [GenBank: NC_015556] [Browse all T6SS(s) in this replicon]
Location [Strand]276124..278826 [-]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDF6AF31
KEGG IDpfv:Psefu_0245
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 5.20E-39, Aligned region: 629..795
AAA_2 [PF07724], Evalue: 5.20E-39, Aligned region: 861..874
AAA [PF00004], Evalue: 2.80E-18, Aligned region: 234..367
AAA [PF00004], Evalue: 2.80E-18, Aligned region: 635..719
ClpB_D2-small [PF10431], Evalue: 6.90E-14, Aligned region: 802..874
AAA_16 [PF13191], Evalue: 1.90E-13, Aligned region: 211..251
AAA_16 [PF13191], Evalue: 1.90E-13, Aligned region: 278..313
AAA_16 [PF13191], Evalue: 1.90E-13, Aligned region: 516..548
AAA_16 [PF13191], Evalue: 1.90E-13, Aligned region: 604..679
AAA_5 [PF07728], Evalue: 2.30E-12, Aligned region: 234..253
AAA_5 [PF07728], Evalue: 2.30E-12, Aligned region: 359..385
AAA_5 [PF07728], Evalue: 2.30E-12, Aligned region: 634..746
AAA_22 [PF13401], Evalue: 7.40E-08, Aligned region: 63..98
AAA_22 [PF13401], Evalue: 7.40E-08, Aligned region: 233..314
AAA_22 [PF13401], Evalue: 7.40E-08, Aligned region: 358..399
AAA_22 [PF13401], Evalue: 7.40E-08, Aligned region: 632..665
AAA_22 [PF13401], Evalue: 7.40E-08, Aligned region: 695..720
Sigma54_activat [PF00158], Evalue: 9.00E-07, Aligned region: 215..247
Sigma54_activat [PF00158], Evalue: 9.00E-07, Aligned region: 634..756
AAA_25 [PF13481], Evalue: 8.70E-06, Aligned region: 229..310
AAA_25 [PF13481], Evalue: 8.70E-06, Aligned region: 484..514
AAA_25 [PF13481], Evalue: 8.70E-06, Aligned region: 630..659
AAA_19 [PF13245], Evalue: 4.70E-05, Aligned region: 234..255
AAA_19 [PF13245], Evalue: 4.70E-05, Aligned region: 632..657
Arch_ATPase [PF01637], Evalue: 9.60E-05, Aligned region: 212..250
Arch_ATPase [PF01637], Evalue: 9.60E-05, Aligned region: 285..339
Arch_ATPase [PF01637], Evalue: 9.60E-05, Aligned region: 634..665
NACHT [PF05729], Evalue: 0.00014, Aligned region: 234..340
NACHT [PF05729], Evalue: 0.00014, Aligned region: 635..667
Zeta_toxin [PF06414], Evalue: 0.00018, Aligned region: 234..250
Zeta_toxin [PF06414], Evalue: 0.00018, Aligned region: 629..674
AAA_14 [PF13173], Evalue: 0.00018, Aligned region: 234..324
AAA_14 [PF13173], Evalue: 0.00018, Aligned region: 633..715
AAA_18 [PF13238], Evalue: 0.00033, Aligned region: 234..252
AAA_18 [PF13238], Evalue: 0.00033, Aligned region: 636..663
IstB_IS21 [PF01695], Evalue: 0.00034, Aligned region: 217..255
IstB_IS21 [PF01695], Evalue: 0.00034, Aligned region: 634..662
AAA_17 [PF13207], Evalue: 0.00035, Aligned region: 234..251
AAA_17 [PF13207], Evalue: 0.00035, Aligned region: 634..670
AAA_17 [PF13207], Evalue: 0.00035, Aligned region: 817..844
AAA_29 [PF13555], Evalue: 0.0014, Aligned region: 226..250
AAA_29 [PF13555], Evalue: 0.0014, Aligned region: 632..659
Torsin [PF06309], Evalue: 0.0033, Aligned region: 591..658
AAA_30 [PF13604], Evalue: 0.0095, Aligned region: 225..250
AAA_30 [PF13604], Evalue: 0.0095, Aligned region: 319..374
AAA_30 [PF13604], Evalue: 0.0095, Aligned region: 633..665
Protein Sequence: 900 a.a.     [Download]
>gi|333898450|ref|YP_004472323.1| type VI secretion ATPase, ClpV1 family [Pseudomonas fulva 12-X]
MSEISRAALFGKLNSVAYKAIEAATVFCKLRGNPYVELSHWLHQILQLQDSDLHQIIRQFSIEPARLAKD
ITEALDRLPRGSTSITDLSSHVEEAVERGWVYGSLMFGESQVRTGYLIVGILKTPSLRNALLAISREFDK
LRVETLTERFDEVVGASPENALTATDGFQAGAAPGEASGAIAPSAMGKQEALKRFTVDLTEQARSGKLDP
IVGRDDEIRQLVDILMRRRQNNPILTGEAGVGKTAVVEGFALRIVAGDVPPSLKDVELRSLDVGLLQAGA
SMKGEFEQRLRQVIEDVQSSPKPIILFIDEAHTLVGAGGAAGAGDAANLLKPALARGTLRTVAATTWAEY
KKHIEKDPALTRRFQVVQVDEPSEHRAILMMRGVASTMEKHHQVQILDEALEASVKLSHRYIPARQLPDK
SVSLLDTACARVAISLHAVPAEVDDSRRRIEALETELAIIGREEAIGVNIGSRRRDSESALAEERSRLAG
LETRWSEEKALVDELLATRASLRAAAEPVDDTSREAGDARLSDEEHAAQRSKLAELQSRLSALQGEDPLI
LPTVDYQAVASVVADWTGIPVGRMARNEIETVLKLDAHLKKRIIGQDHALEMIAKRIQTSRAGLDNPNKP
IGVFMLAGTSGVGKTETALALAEALYGGEQNVITINMSEFQEAHTVSTLKGAPPGYIGYGEGGVLTEAVR
RRPYSVVLLDEVEKAHPDVHEIFFQVFDKGVMEDGEGRQIDFKNTLILLTTNAGTEMIAGLCSDPELMPE
PEGIAKALREPLLKIFPPALLGRLVTIPYYPLSDDMLKAITRLQLERIKKRIESTHKVPFSYDDAVVDLV
VSRCTENESGGRQIDAILTNSMLPDMSREFLGRLLEGKPLAGVQVSVQNQDLHYEFAATQ
 
Nucleotide Sequence: 2703 bp     [Download]
>gi|333898208|ref|NC_015556.1|:c278826-276124 Pseudomonas fulva 12-X chromosome, complete genome
ATGAGTGAAATCAGTCGCGCCGCGTTGTTCGGCAAGCTCAACAGCGTCGCTTACAAGGCCATCGAAGCCG
CCACCGTGTTCTGCAAGCTGCGTGGCAACCCCTATGTCGAACTGAGCCACTGGCTGCACCAGATCCTGCA
GCTGCAGGATTCCGACCTGCACCAGATCATCCGCCAGTTCAGCATCGAGCCGGCACGCCTGGCCAAGGAC
ATCACCGAGGCCCTGGACCGCCTGCCGCGCGGCTCCACCTCGATCACCGACCTGTCCTCCCATGTCGAGG
AAGCGGTCGAGCGCGGCTGGGTCTACGGCAGCCTGATGTTCGGCGAAAGCCAGGTGCGCACCGGCTACCT
GATCGTCGGCATCCTCAAGACGCCAAGCCTGCGCAACGCGCTGCTGGCCATCTCCCGGGAGTTCGACAAG
CTCAGGGTCGAGACCCTCACCGAGCGCTTCGATGAAGTGGTCGGCGCCTCGCCGGAAAACGCCCTGACCG
CCACCGACGGCTTCCAGGCCGGCGCTGCGCCGGGCGAGGCCAGCGGCGCCATCGCGCCGAGCGCCATGGG
CAAGCAGGAAGCGCTCAAGCGCTTCACCGTCGACCTCACCGAACAGGCGCGCAGCGGCAAGCTCGACCCC
ATCGTCGGCCGTGACGACGAGATTCGCCAACTGGTCGATATCCTCATGCGCCGCCGCCAGAACAACCCGA
TCCTCACCGGCGAAGCCGGCGTGGGCAAGACGGCGGTGGTCGAAGGCTTCGCCCTGCGCATCGTCGCCGG
CGACGTACCGCCGAGCCTCAAGGACGTCGAGCTGCGCAGCCTGGACGTCGGCCTGCTGCAGGCCGGCGCC
AGCATGAAGGGTGAATTCGAGCAGCGCCTGCGCCAGGTCATCGAGGACGTGCAGAGCTCGCCCAAGCCGA
TCATCCTGTTCATCGACGAAGCCCACACCCTGGTCGGCGCTGGTGGCGCGGCCGGCGCCGGCGACGCCGC
CAACCTGCTCAAGCCAGCCCTGGCCCGCGGCACCCTGCGCACCGTGGCGGCCACCACCTGGGCCGAGTAC
AAGAAACACATCGAGAAGGACCCGGCCCTGACCCGTCGCTTCCAGGTGGTACAGGTCGACGAGCCTTCCG
AGCATCGCGCCATCCTGATGATGCGCGGCGTCGCCTCGACCATGGAAAAGCACCATCAGGTGCAGATTCT
CGACGAAGCCCTGGAAGCTTCGGTCAAGCTGTCGCACCGCTACATCCCGGCGCGCCAGTTGCCGGACAAG
TCGGTCAGCCTGCTCGATACCGCCTGCGCCCGCGTTGCCATCAGCCTGCACGCGGTGCCCGCCGAGGTGG
ACGACAGTCGTCGACGCATCGAAGCCCTGGAAACCGAGCTGGCCATCATCGGCCGCGAAGAAGCCATCGG
CGTGAACATCGGCAGCCGCCGCCGCGACAGCGAATCAGCGCTGGCCGAAGAGCGCAGCCGCCTTGCCGGC
CTGGAAACACGCTGGAGCGAAGAGAAGGCGTTGGTCGACGAGCTGCTGGCCACCCGCGCCAGCCTGCGCG
CCGCCGCCGAGCCGGTGGACGACACCAGCCGCGAGGCCGGCGACGCCCGCCTGAGCGACGAGGAACACGC
GGCCCAGCGCAGCAAGCTCGCCGAGCTGCAGAGCCGCCTGAGCGCCCTGCAGGGCGAAGACCCGCTGATC
CTGCCGACCGTCGATTACCAGGCGGTGGCCTCGGTGGTCGCCGACTGGACCGGCATTCCGGTCGGGCGCA
TGGCGCGCAACGAGATCGAGACCGTTCTCAAGCTGGACGCGCACCTGAAGAAACGCATCATCGGCCAGGA
CCACGCCCTGGAAATGATCGCCAAGCGCATCCAGACCTCCCGCGCCGGGCTCGACAACCCCAACAAGCCG
ATCGGCGTATTCATGCTCGCCGGCACCTCCGGCGTGGGCAAGACCGAAACCGCCCTGGCGCTGGCCGAAG
CCCTGTATGGCGGTGAGCAGAACGTCATCACCATCAACATGAGCGAGTTCCAGGAAGCCCACACGGTGTC
CACCCTCAAGGGCGCGCCACCGGGCTACATCGGCTACGGCGAGGGCGGCGTACTGACCGAAGCGGTGCGC
CGGCGCCCCTACAGCGTAGTGTTGCTCGACGAGGTCGAGAAGGCGCACCCGGATGTCCACGAGATTTTCT
TCCAAGTGTTCGACAAGGGCGTGATGGAAGACGGCGAAGGCCGCCAGATCGACTTCAAGAATACCCTGAT
CCTGCTCACCACCAACGCCGGCACCGAGATGATCGCCGGGCTGTGCAGCGACCCGGAGCTGATGCCCGAG
CCTGAAGGCATCGCCAAGGCGCTGCGCGAGCCGCTGCTGAAGATCTTCCCGCCGGCCCTGCTCGGCCGCC
TGGTGACCATCCCCTACTACCCGCTGTCGGACGACATGCTCAAGGCCATCACCCGCCTGCAGCTGGAGCG
CATCAAGAAGCGCATCGAAAGCACCCACAAGGTGCCGTTCAGTTACGACGATGCGGTGGTCGACCTGGTG
GTGTCGCGCTGCACCGAGAACGAGAGCGGTGGCCGGCAGATCGACGCGATCCTCACCAACAGCATGCTGC
CGGACATGAGCCGCGAGTTCCTCGGCCGCCTGCTCGAAGGCAAACCGCTCGCCGGCGTGCAGGTCAGCGT
GCAGAACCAGGATCTGCACTATGAGTTTGCGGCAACGCAGTAA