SecReT6
Protein ID: 333898451
SecReT6 ID439
T6SS typei3
Gene symbol-
Locus tagPsefu_0246
StrainPseudomonas fulva 12-X
Repliconchromosome [GenBank: NC_015556] [Browse all T6SS(s) in this replicon]
Location [Strand]278838..279851 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDF6AF32
KEGG IDpfv:Psefu_0246
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.80E-111, Aligned region: 14..313
Protein Sequence: 337 a.a.     [Download]
>gi|333898451|ref|YP_004472324.1| type VI secretion protein [Pseudomonas fulva 12-X]
MSADALNSLAAMAEAPWNYDFFQAMRRIECEYPEHPRLGHSVRLVDDPLRLGQKPDCGFAPSTLASVIHD
STGTPRIEQFFFGLTGPNGPLPIHLTEHARERQRHHGDATFKRFLDVFNHRLLTLFYRAWAEARPTVAQD
RATDDYWSPRLGALSGRGMDSLLGQGPIPDAARYYFTGHLAAQTRYPDGLQAILAEYFGVPVALEEYVGQ
WLPLPEYSRLGASTCTLGMDLCLGTHVWDRQHKFRLRIGPLSLAQYRRFLPDQPLLAELAAWVAEYVGME
LDWDTNLVLKQEEVPPASLDGGCRLGFDTWLGKPREDAKDLLLDRRHIATQPLTTPN
 
Nucleotide Sequence: 1014 bp     [Download]
>gi|333898208|ref|NC_015556.1|:c279851-278838 Pseudomonas fulva 12-X chromosome, complete genome
ATGTCGGCCGACGCTTTGAACAGCCTGGCGGCGATGGCCGAAGCGCCCTGGAACTACGATTTCTTCCAGG
CCATGCGGCGCATCGAGTGCGAGTACCCGGAGCACCCGCGCCTCGGCCATTCCGTGCGCCTGGTCGACGA
CCCGCTACGCCTGGGCCAGAAGCCGGACTGCGGCTTCGCGCCTTCTACCCTGGCCAGCGTCATCCACGAC
AGCACCGGCACGCCGCGTATCGAGCAGTTCTTCTTCGGCCTCACCGGCCCCAACGGGCCGCTGCCGATTC
ACCTGACCGAGCATGCCCGCGAGCGCCAGCGTCACCACGGCGACGCCACCTTCAAGCGCTTTCTCGATGT
TTTCAACCATCGCCTGCTGACCCTGTTCTACCGCGCCTGGGCAGAAGCCCGGCCAACGGTGGCCCAGGAT
CGCGCCACCGACGACTACTGGTCGCCGCGCCTCGGCGCGCTGTCTGGCCGCGGTATGGATAGCCTGCTCG
GCCAGGGCCCGATCCCGGACGCGGCGCGCTATTACTTCACCGGTCATCTGGCCGCCCAGACCCGCTACCC
CGATGGCCTGCAGGCGATCCTCGCCGAATACTTCGGCGTGCCGGTGGCGCTCGAGGAATACGTCGGCCAG
TGGCTGCCGCTGCCGGAATACAGCCGCCTGGGCGCCAGCACCTGCACCCTGGGCATGGACCTGTGCCTGG
GCACCCACGTATGGGATCGGCAACACAAATTCCGCCTGCGCATCGGCCCGCTCAGCCTGGCGCAATACCG
CCGCTTCCTGCCCGACCAGCCGCTGCTCGCCGAACTGGCGGCGTGGGTGGCCGAGTACGTCGGCATGGAA
CTGGACTGGGACACCAACCTGGTGCTCAAACAGGAGGAGGTACCGCCCGCATCACTGGATGGCGGCTGCC
GACTCGGCTTCGATACCTGGCTCGGCAAGCCGCGCGAGGATGCAAAGGATCTGCTGCTGGATAGGCGTCA
CATCGCCACCCAGCCGCTCACTACCCCGAATTAG