SecReT6
Protein ID: 333898452
SecReT6 ID439
T6SS typei3
Gene symbol-
Locus tagPsefu_0247
StrainPseudomonas fulva 12-X
Repliconchromosome [GenBank: NC_015556] [Browse all T6SS(s) in this replicon]
Location [Strand]279833..281692 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDF6AF33
KEGG IDpfv:Psefu_0247
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.20E-223, Aligned region: 5..618
Protein Sequence: 619 a.a.     [Download]
>gi|333898452|ref|YP_004472325.1| type VI secretion protein [Pseudomonas fulva 12-X]
MNPRLLGYYNQELQHIRESAEEFAREFPKIASRLSLSGVECADPYVERLLEGFAYLTARVQLKLDAEYPT
FTHNLLEIAYPHYLAPTPSMTVVQLCADPNEGSLSSGFTLERGASLRGALGSEAQTACEYRTCQPVTLWP
LEVTQASYFGNPSTQLGRLAASEPGAKAAVRVRLRTGAGLPFNALDLDELTFYLHGADEQPFRLYEQLMG
NVCALFVRAVDGSWVERLPPDSLCPRGFDDQDAALPVVPRAFQGYRLLQEYFALPNRFLFVELTGLKRAV
QRNASQELELVVLFNRLDNSLENSIGAEQFRLFCTPAINLFARRADRIHLSDRVHEHQIIADRTRPQDFE
IHSVTEVSGHGSGPEQPFQPFYAVRDPSRYGREQAWYSLRREPRVLSSKQRRNGPRSTYVGSETFISLVD
ANQAPYRHDLRQLGIGTLCTNRDLPLSMPIGGTRSDFTLEDSAPVVAVRCLAGPSRPRASRAHDASAWRL
ISQLSLNYLSLSEQGQGAAALRELLRLYGDVGDNALQLQIDGLRKVTAQPCTRRLPMPGPIVFGRGLEIG
LEFDENAFRGTGMFLLGSVLERFLTRYVSINSFTETVLRTTERGEVMRWRAKPGCRPTL
 
Nucleotide Sequence: 1860 bp     [Download]
>gi|333898208|ref|NC_015556.1|:c281692-279833 Pseudomonas fulva 12-X chromosome, complete genome
ATGAACCCGCGCCTGCTCGGTTACTACAATCAGGAGCTGCAGCACATCCGCGAAAGCGCGGAGGAGTTCG
CCCGCGAATTCCCGAAGATCGCCAGCCGCCTGAGCCTGTCCGGCGTCGAATGCGCCGACCCCTACGTGGA
ACGCCTGCTCGAAGGTTTCGCCTACCTGACCGCGCGAGTGCAGCTCAAGCTCGACGCCGAATACCCGACC
TTCACCCACAACCTGCTGGAAATCGCCTACCCGCACTACCTGGCGCCGACCCCGTCGATGACCGTGGTGC
AGTTGTGTGCCGATCCCAACGAAGGTTCATTGAGCAGCGGCTTCACCCTCGAGCGCGGCGCCTCGCTGCG
CGGCGCCCTGGGCAGCGAGGCGCAGACCGCCTGCGAATATCGCACCTGCCAGCCAGTCACCCTGTGGCCG
CTGGAGGTCACCCAGGCCAGCTATTTCGGTAATCCGAGCACCCAGCTCGGCCGCCTGGCGGCAAGCGAGC
CGGGCGCCAAGGCCGCCGTGCGCGTGCGCCTGCGTACCGGTGCCGGGCTACCGTTCAATGCGCTGGATCT
CGACGAGCTGACGTTCTATCTGCACGGCGCCGACGAGCAGCCGTTCCGGCTCTACGAACAACTGATGGGT
AACGTCTGCGCCCTATTCGTCCGTGCCGTGGACGGTTCCTGGGTCGAGCGCCTGCCGCCGGACAGCCTGT
GCCCGCGCGGCTTCGATGATCAGGACGCCGCACTGCCGGTGGTACCCCGCGCCTTCCAGGGCTATCGCCT
GCTGCAGGAATACTTCGCCCTGCCCAACCGCTTCCTGTTCGTCGAGCTGACCGGCCTCAAGCGCGCCGTG
CAGCGCAATGCCAGCCAGGAGCTGGAGCTGGTAGTGCTGTTCAACCGCCTCGACAACAGCCTGGAAAACA
GCATCGGTGCCGAGCAGTTCCGGCTGTTCTGCACCCCGGCGATCAACCTGTTCGCCCGCCGTGCCGACCG
CATTCACCTGAGCGACCGCGTGCACGAGCACCAGATCATCGCCGACCGCACCCGACCGCAGGATTTCGAG
ATCCATTCGGTCACCGAGGTCAGCGGCCATGGCAGCGGCCCCGAACAGCCGTTCCAGCCGTTCTACGCGG
TGCGCGACCCGTCGCGTTATGGTCGCGAACAGGCCTGGTACAGCCTGCGCCGCGAGCCTCGCGTGCTGTC
GAGCAAGCAACGGCGCAACGGCCCGCGCTCGACCTACGTGGGTAGCGAGACCTTCATCTCCCTGGTCGAC
GCCAATCAGGCGCCCTACCGCCATGACCTGCGCCAATTGGGCATCGGCACGCTGTGCACCAACCGCGACC
TGCCGCTGTCGATGCCGATCGGCGGCACGCGCAGCGACTTCACCCTCGAAGACAGCGCCCCGGTGGTCGC
CGTGCGCTGCCTGGCCGGCCCCAGCCGCCCACGGGCCAGCCGCGCCCACGATGCCAGCGCCTGGCGCCTG
ATCAGCCAGCTGTCGCTCAACTATCTGTCGCTCAGCGAGCAAGGTCAGGGCGCCGCCGCGCTGCGCGAAC
TGCTGCGCCTGTACGGTGATGTCGGCGACAACGCCCTGCAGCTGCAGATCGACGGCCTGCGCAAGGTCAC
CGCCCAGCCATGCACGCGGCGCCTGCCAATGCCGGGGCCGATCGTATTCGGGCGTGGCCTGGAGATCGGC
CTGGAGTTCGACGAGAACGCCTTCCGCGGCACCGGCATGTTCCTGCTCGGTTCGGTGCTGGAGCGCTTCC
TGACCCGTTACGTGTCGATCAACAGCTTCACCGAGACGGTGCTGCGTACCACCGAACGTGGCGAAGTGAT
GCGCTGGAGGGCCAAGCCCGGATGTCGGCCGACGCTTTGA