SecReT6
Protein ID: 333898453
SecReT6 ID439
T6SS typei3
Gene symbol-
Locus tagPsefu_0248
StrainPseudomonas fulva 12-X
Repliconchromosome [GenBank: NC_015556] [Browse all T6SS(s) in this replicon]
Location [Strand]281689..282204 [-]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDF6AF34
KEGG IDpfv:Psefu_0248
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.90E-21, Aligned region: 36..145
Protein Sequence: 171 a.a.     [Download]
>gi|333898453|ref|YP_004472326.1| type VI secretion system lysozyme-like protein [Pseudomonas fulva 12-X]
MADLKRQERLQPALLDRLLDDDPSNPAESVDKRVLTLNQLRASVLRDLAWLFNTIAPLTSDDEALTRAGS
SVVNFGLPPLAGHSASSIDIPAVERLLTKAIADFEPRIVRSSLRVRARQEAEEMNHNSLSFEIEGDLWAH
PMPLRLLLTTELDLETGHVQVLPADASRRRR
 
Nucleotide Sequence: 516 bp     [Download]
>gi|333898208|ref|NC_015556.1|:c282204-281689 Pseudomonas fulva 12-X chromosome, complete genome
ATGGCCGACCTGAAACGTCAGGAGCGCCTGCAGCCCGCCCTGCTCGACCGCCTGCTCGACGACGACCCGA
GCAACCCGGCGGAGAGCGTCGACAAGCGCGTGCTGACCCTTAACCAGCTGCGCGCGTCGGTGCTGCGCGA
CCTGGCCTGGCTGTTCAATACCATCGCCCCGCTGACCAGCGACGACGAGGCCCTGACCCGGGCCGGCAGT
TCGGTGGTCAACTTCGGCCTGCCGCCGCTGGCCGGGCATAGCGCCTCGAGCATCGACATACCCGCGGTCG
AGCGCCTGCTGACCAAGGCAATCGCCGACTTCGAGCCGCGCATCGTGCGCTCGTCGCTGCGCGTGCGCGC
CCGCCAGGAGGCCGAGGAAATGAACCACAACTCCCTCAGCTTCGAGATCGAGGGTGATCTCTGGGCCCAC
CCGATGCCGCTGCGCCTGCTGCTGACCACCGAACTGGATCTGGAAACCGGGCACGTGCAGGTGCTGCCCG
CCGACGCCTCACGGAGACGCCGATGA