SecReT6
Protein ID: 333898454
SecReT6 ID439
T6SS typei3
Gene symbol-
Locus tagPsefu_0249
StrainPseudomonas fulva 12-X
Repliconchromosome [GenBank: NC_015556] [Browse all T6SS(s) in this replicon]
Location [Strand]282192..282992 [-]
Productvirulence protein SciE type
NoteTagJ
UniProt IDF6AF35
KEGG IDpfv:Psefu_0249
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 9.00E-42, Aligned region: 59..74
ImpE [PF07024], Evalue: 9.00E-42, Aligned region: 137..256
TPR_16 [PF13432], Evalue: 0.00065, Aligned region: 3..57
TPR_16 [PF13432], Evalue: 0.00065, Aligned region: 116..128
Protein Sequence: 266 a.a.     [Download]
>gi|333898454|ref|YP_004472327.1| virulence protein SciE type [Pseudomonas fulva 12-X]
MTAEQYLRNAQLDDALKALQDQVRAQPAKAELRVFLFQLLAVMGQWSRAQNQLKVAGELDAACLPMVQTY
STALNCEALREQVFAGKTTPVVLGQPAEWVAPLILALEQDAQGNAAAAQSLRDQAFEAAAAVPGTLDDTP
FTWLADADPRLGPVLELIVNGRYVWLPMENIASLAVEAPSDLRDLVWLPAQLTLTNGGSTVALIPSRYPG
THASSDGALRLARKTEWQDDGVPLGQRLLAFDGGDQALFDLRTLSFEHGNAAAWPT
 
Nucleotide Sequence: 801 bp     [Download]
>gi|333898208|ref|NC_015556.1|:c282992-282192 Pseudomonas fulva 12-X chromosome, complete genome
ATGACTGCCGAACAATACCTGCGTAACGCACAGCTCGACGACGCGCTGAAGGCGCTGCAGGACCAGGTTC
GGGCGCAACCGGCCAAAGCCGAACTGCGCGTGTTCCTGTTCCAGCTGCTGGCGGTGATGGGCCAATGGAG
CCGTGCGCAGAATCAGCTGAAGGTCGCCGGCGAGCTGGACGCCGCCTGCCTGCCGATGGTGCAGACCTAC
AGCACGGCGCTGAACTGCGAGGCTCTGCGCGAGCAGGTGTTCGCCGGCAAGACCACGCCCGTGGTGCTCG
GCCAGCCCGCCGAATGGGTCGCGCCGCTGATTCTCGCCCTCGAACAGGACGCCCAGGGCAATGCTGCCGC
CGCCCAGAGCCTGCGTGACCAGGCCTTCGAAGCGGCTGCCGCGGTGCCGGGCACGCTCGACGACACCCCC
TTCACCTGGTTGGCCGACGCCGACCCGCGCCTTGGCCCGGTGCTGGAACTGATCGTCAACGGTCGCTACG
TCTGGCTGCCCATGGAAAACATCGCCAGCCTCGCCGTCGAAGCACCCAGTGATTTGCGTGACTTGGTCTG
GCTGCCGGCCCAGTTGACCCTGACCAACGGCGGCAGCACCGTGGCGCTGATCCCCAGTCGCTACCCTGGA
ACACACGCCAGCAGCGACGGTGCACTGCGCCTGGCCCGCAAGACCGAATGGCAGGACGACGGCGTACCGC
TCGGCCAGCGTCTGCTGGCCTTCGATGGCGGCGACCAGGCGCTGTTCGATCTGCGCACGCTGAGCTTCGA
GCACGGGAATGCTGCGGCATGGCCGACCTGA