SecReT6
Protein ID: 333898456
SecReT6 ID439
T6SS typei3
Gene symbol-
Locus tagPsefu_0251
StrainPseudomonas fulva 12-X
Repliconchromosome [GenBank: NC_015556] [Browse all T6SS(s) in this replicon]
Location [Strand]283717..285210 [-]
Producttype VI secretion protein EvpB
NoteTssC
UniProt IDF6AF37
KEGG IDpfv:Psefu_0251
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.60E-195, Aligned region: 66..492
BMFP [PF04380], Evalue: 0.0026, Aligned region: 17..77
Protein Sequence: 497 a.a.     [Download]
>gi|333898456|ref|YP_004472329.1| type VI secretion protein EvpB [Pseudomonas fulva 12-X]
MSQQTQASEQSLATSEQTSEFASLLLQEFKPKTERAREAVETAVRTLAEHALSKTDLISDDAIKSVESII
AAIDAKLTAQVNLIMHHPDFQQLESAWRGLHYLVNNTETDEQLKIRVLNISKTELHKTLKKFKGTAWDQS
PIFKKLYEEEYGQFGGEPYGCLVGDYYFDQSPPDVELLGEIAKISAAMHSPFISAASPTVMGMGSWQELS
NPRDLTKIFTTPEYAGWRSLRDSEDSRYIGLTMPRFLARQPYGAKTDPVEEFAFEEETDGADSSKYTWAN
SAYAMAVNINRSFKLYGWCSRIRGVESGGEVPNLPAHTFPTDDGGVDMKCPTEIAISDRREAELAKNGFM
PLLHKKNTDLAAFIGAQSLHKPAEYDDPDATANANLAARLPYLFATCRFAHYLKCIVRDKIGSFKERDEM
QRWLQDWILNYVDGDPAHSTETTKAQHPLAEAEVVVEEIEGNPGYYSSKFYLRPHYQLEGLTVSLRLVSK
LPSAKGA
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|333898208|ref|NC_015556.1|:c285210-283717 Pseudomonas fulva 12-X chromosome, complete genome
ATGAGCCAACAGACCCAGGCGTCCGAACAGTCGCTCGCCACCTCCGAACAGACCAGCGAATTCGCCTCGC
TGCTGCTGCAGGAATTCAAACCCAAGACCGAGCGCGCCCGTGAAGCGGTGGAAACCGCCGTGCGCACCCT
GGCCGAGCATGCCCTGAGCAAGACCGACCTGATCTCCGACGACGCCATCAAGTCGGTGGAATCGATCATC
GCCGCGATCGACGCCAAGCTCACCGCCCAGGTCAACCTGATCATGCACCACCCGGATTTCCAGCAGCTGG
AAAGCGCCTGGCGTGGCCTGCACTACCTGGTCAACAACACCGAGACCGACGAGCAGCTGAAGATCCGCGT
GCTCAACATCTCCAAGACCGAGCTGCACAAGACCCTGAAGAAATTCAAGGGCACCGCCTGGGACCAGAGC
CCGATCTTCAAGAAGCTCTACGAAGAGGAATACGGTCAGTTCGGTGGCGAGCCCTACGGCTGCCTGGTGG
GCGACTACTACTTCGACCAGTCGCCGCCCGATGTCGAACTGCTCGGCGAGATCGCCAAGATCTCCGCGGC
CATGCACTCGCCGTTCATTTCCGCGGCCTCGCCGACGGTCATGGGCATGGGTTCCTGGCAGGAGCTGTCC
AACCCGCGCGACCTGACCAAGATCTTCACCACGCCCGAATACGCCGGCTGGCGCTCGCTGCGTGACTCCG
AGGATTCGCGCTACATCGGTCTGACCATGCCGCGCTTCCTGGCGCGTCAGCCCTACGGCGCGAAGACCGA
CCCGGTTGAAGAGTTCGCCTTCGAGGAAGAAACCGACGGCGCCGACAGCAGCAAGTACACCTGGGCCAAC
TCGGCGTACGCCATGGCGGTCAACATCAACCGTTCGTTCAAGCTCTACGGCTGGTGCTCGCGCATCCGCG
GCGTGGAGTCGGGCGGTGAAGTGCCGAACCTGCCGGCGCACACCTTCCCCACCGACGACGGTGGCGTGGA
CATGAAGTGCCCGACCGAGATCGCCATCTCCGACCGCCGCGAGGCCGAGCTGGCGAAGAACGGTTTCATG
CCGCTGCTGCACAAGAAGAACACCGACCTGGCCGCCTTCATCGGCGCCCAGTCGCTGCACAAGCCGGCCG
AGTACGACGATCCGGACGCCACCGCCAACGCCAACTTGGCCGCGCGCCTGCCGTACCTGTTCGCCACCTG
CCGCTTCGCCCACTACCTGAAGTGCATCGTGCGCGACAAGATCGGCTCGTTCAAAGAGCGCGACGAGATG
CAGCGCTGGTTGCAGGACTGGATCCTCAACTACGTCGACGGTGACCCGGCGCACTCCACCGAAACCACCA
AGGCCCAGCACCCACTGGCCGAAGCCGAAGTGGTGGTCGAGGAGATCGAGGGCAACCCGGGCTACTACAG
CTCCAAGTTCTATCTGCGCCCGCACTATCAGCTCGAAGGGCTGACCGTGTCGCTGCGCCTGGTATCCAAA
CTGCCTTCGGCCAAGGGGGCCTGA