SecReT6
Protein ID: 333898457
SecReT6 ID439
T6SS typei3
Gene symbol-
Locus tagPsefu_0252
StrainPseudomonas fulva 12-X
Repliconchromosome [GenBank: NC_015556] [Browse all T6SS(s) in this replicon]
Location [Strand]285223..285741 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDF6AF38
KEGG IDpfv:Psefu_0252
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.50E-59, Aligned region: 11..164
Protein Sequence: 172 a.a.     [Download]
>gi|333898457|ref|YP_004472330.1| type VI secretion protein [Pseudomonas fulva 12-X]
MSNTTSSQKFIARNRAPRVQIEYDVELYGAEKKVQLPFVMGVMADLAGKPEEPLAAVADRKFLEIDADNF
DSRLKAMKPRAAFHVPNALTGEGNLSLDITFESMDDFSPAAIARKVDSLNQLLEARTQLANLLTYMDGKT
GAEELIIKAIKDPALLQALASAPKPQDNEPQA
 
Nucleotide Sequence: 519 bp     [Download]
>gi|333898208|ref|NC_015556.1|:c285741-285223 Pseudomonas fulva 12-X chromosome, complete genome
ATGAGTAACACCACCAGCAGCCAGAAATTCATCGCGCGCAACCGCGCCCCGCGGGTGCAGATCGAGTACG
ACGTTGAGCTGTACGGCGCCGAGAAAAAGGTGCAGTTGCCCTTCGTCATGGGCGTGATGGCAGACCTCGC
CGGCAAGCCGGAAGAGCCGTTGGCCGCCGTCGCCGACCGCAAGTTCCTGGAAATCGACGCCGACAACTTC
GACTCACGCCTCAAGGCCATGAAGCCGCGCGCGGCTTTCCACGTGCCCAACGCCCTGACTGGTGAAGGCA
ACCTGAGCCTGGACATCACCTTCGAGAGCATGGACGACTTCAGCCCGGCGGCCATCGCCCGTAAGGTCGA
CTCGCTCAACCAGCTGCTCGAAGCGCGCACCCAGCTCGCCAACCTGCTGACCTACATGGACGGCAAGACC
GGTGCCGAAGAGCTGATCATCAAGGCGATCAAGGACCCGGCCCTGCTGCAGGCCCTGGCCAGTGCGCCCA
AGCCCCAAGACAACGAGCCGCAAGCCTAA