SecReT6
Protein ID: 333898458
SecReT6 ID439
T6SS typei3
Gene symbol-
Locus tagPsefu_0253
StrainPseudomonas fulva 12-X
Repliconchromosome [GenBank: NC_015556] [Browse all T6SS(s) in this replicon]
Location [Strand]286003..287043 [-]
Producttype VI secretion-associated protein, ImpA family
NoteTssA
UniProt IDF6AF39
KEGG IDpfv:Psefu_0253
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.50E-21, Aligned region: 53..113
Protein Sequence: 346 a.a.     [Download]
>gi|333898458|ref|YP_004472331.1| type VI secretion-associated protein, ImpA family [Pseudomonas fulva 12-X]
MVDVSHLLNPVSDETPHGEDLEYDADFLELERLAQGQPERQMGQSVIAAEPPDWRQVRERASDLFARSKD
LRLASLYLQSAIALEGLNGLAQGLTLVRELLTQFWEGVYPQLDADDDNDPTIRINALNALSAEPVIVLLR
EASITRSRAFGAVSIRAALNAADLQRFSSETLSPEQLRGAFLDTDAELLDSTRVALDEAAAALADIEGLL
SERVGSAQSANLESLKQVLRHARQIFNDQAPAGDDESSYSSEEMPTDSDAGDAQSSAPPAARQAPAAPGR
IASRDDVLRTLDRLLEYYAQHEPSSPVPVLLTRAQKLVTADFAEIVRNLIPDGMSQFENLRGPEYD
 
Nucleotide Sequence: 1041 bp     [Download]
>gi|333898208|ref|NC_015556.1|:c287043-286003 Pseudomonas fulva 12-X chromosome, complete genome
GTGGTGGATGTGTCGCACCTGCTCAACCCGGTATCCGACGAGACGCCGCACGGCGAAGACCTCGAATACG
ACGCCGACTTTCTCGAGCTCGAGCGCCTCGCCCAGGGCCAGCCGGAACGGCAGATGGGCCAGTCGGTCAT
CGCTGCCGAGCCGCCGGACTGGCGCCAGGTGCGCGAACGCGCCAGCGACCTGTTCGCCCGCAGCAAGGAC
TTGCGCCTGGCCAGCCTGTACCTGCAGAGCGCCATCGCCCTCGAGGGCCTGAATGGCCTGGCCCAGGGCC
TGACCCTGGTACGCGAGCTGCTGACCCAGTTCTGGGAAGGCGTCTACCCGCAGCTCGACGCCGATGATGA
CAACGACCCGACCATCCGCATCAACGCACTCAATGCCCTGAGCGCCGAGCCGGTGATCGTGCTGCTGCGC
GAAGCCAGCATCACCCGCTCGCGGGCCTTCGGTGCGGTGAGCATTCGCGCCGCCCTGAACGCCGCCGACC
TGCAGCGTTTCTCCAGCGAAACCCTGTCGCCCGAACAACTGCGCGGCGCCTTCCTGGACACCGATGCCGA
GCTGCTCGACAGCACCCGCGTCGCCCTCGACGAGGCCGCCGCGGCCCTGGCCGATATCGAGGGCCTGCTC
AGCGAGCGCGTCGGCTCAGCGCAAAGTGCCAATCTCGAATCACTCAAGCAGGTGCTGCGCCACGCCCGGC
AGATCTTCAACGACCAGGCGCCCGCTGGCGACGATGAGTCGTCTTACAGCAGCGAAGAAATGCCCACCGA
CAGCGACGCCGGTGACGCCCAAAGCAGTGCGCCACCAGCAGCGCGCCAGGCGCCTGCCGCACCCGGCCGG
ATCGCCAGCCGCGACGACGTGCTGCGTACCCTCGATCGCCTGCTCGAATATTACGCCCAGCACGAACCTT
CCAGCCCGGTCCCGGTCTTACTGACGCGCGCGCAGAAGCTGGTCACCGCGGATTTCGCGGAAATCGTGCG
CAATCTGATTCCCGACGGTATGTCGCAGTTCGAAAACCTGCGCGGACCCGAATACGACTAA