SecReT6
Protein ID: 333898459
SecReT6 ID439
T6SS typei3
Gene symbol-
Locus tagPsefu_0254
StrainPseudomonas fulva 12-X
Repliconchromosome [GenBank: NC_015556] [Browse all T6SS(s) in this replicon]
Location [Strand]287403..288983 [+]
ProductFHA domain-containing protein
NoteFha
UniProt IDF6AF40
KEGG IDpfv:Psefu_0254
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.80E-15, Aligned region: 29..97
Protein Sequence: 526 a.a.     [Download]
>gi|333898459|ref|YP_004472332.1| FHA domain-containing protein [Pseudomonas fulva 12-X]
MPLRLFITTYHKLTPGQRAEVELDRGELKIGRSAGNDWVLPDPERLVSSQHCVIQYRDGTYYITDTSTNG
VILQNAGTRLRRGSSEPLQDGEVLKIGEYEIRVQISGISVAPTAPPASGMADDPFNSFEALLSRSAQPLE
MPPVNPAPTAPAPRRDSPFDTKPDLFDFLSPPPAVAPSVSDHVPAQQHDFRPPRPTQPAPAVLPVELPEA
APASVIPADWDPFADLQAAAKPQPIPDPFAAPPRVDAPQIPDPFAAPPQAEAPPIPDPFADLAPLPAVEI
PAFTVEQPPVEPVQPPPVAEPVAKPQPAPAPAPAPAPAPAPAPTAPSAVDDGELMEAFLRGAGLQHLRLD
RAAAVAQMEAIGRSYRLMVEGLIDVLRARASLKGEFRMAQTMIQPVQNNPLKFAPNVDEALLMLLRHDNQ
AFMAPDQAVGESFDDLRAHQLALMAGVQAAIKYLLARFEPRELEGRLNKPSGLSALLPNGRRAHYWELFT
ELYATISQEAEDGFQELFGREFSRAYEEHIARLRGR
 
Nucleotide Sequence: 1581 bp     [Download]
>gi|333898208|ref|NC_015556.1|:287403-288983 Pseudomonas fulva 12-X chromosome, complete genome
ATGCCGTTGCGCTTGTTCATCACCACGTACCACAAGCTGACCCCGGGGCAACGGGCGGAGGTCGAGCTCG
ATCGCGGTGAGCTGAAGATCGGGCGCAGCGCCGGCAACGACTGGGTGCTGCCCGACCCCGAGCGTCTGGT
GTCCAGCCAGCACTGCGTGATCCAGTACCGCGACGGCACCTACTACATCACCGATACCAGCACCAACGGG
GTGATCCTGCAGAACGCCGGCACGCGTCTGCGCCGCGGCAGCAGCGAGCCGCTGCAAGACGGCGAGGTGC
TGAAGATCGGCGAATACGAGATTCGCGTGCAGATCAGCGGGATCAGCGTTGCCCCGACTGCGCCGCCGGC
ATCCGGTATGGCCGACGACCCATTCAACAGTTTCGAGGCGCTGCTCAGCCGCAGTGCCCAGCCGCTGGAA
ATGCCGCCGGTCAATCCCGCGCCGACCGCCCCGGCGCCGCGTCGCGATTCGCCATTCGATACCAAGCCGG
ATCTGTTCGATTTTCTCAGCCCGCCGCCGGCCGTGGCGCCGTCGGTGTCCGATCACGTGCCGGCCCAGCA
GCATGACTTCCGGCCGCCGCGCCCGACGCAACCGGCGCCTGCGGTGTTGCCTGTCGAGCTGCCTGAAGCC
GCACCAGCCTCGGTGATTCCGGCGGACTGGGATCCGTTCGCCGACTTGCAGGCCGCGGCGAAGCCCCAGC
CGATTCCCGATCCCTTTGCCGCGCCGCCCAGGGTGGACGCGCCGCAGATTCCGGACCCCTTCGCCGCTCC
GCCGCAAGCCGAGGCGCCGCCGATCCCGGATCCGTTCGCCGACCTGGCGCCGCTGCCGGCCGTGGAAATC
CCCGCGTTTACCGTGGAACAGCCGCCAGTTGAGCCGGTTCAGCCGCCGCCGGTTGCCGAGCCGGTGGCGA
AACCCCAGCCTGCACCTGCACCTGCACCTGCACCTGCACCTGCACCTGCACCTGCACCTACAGCGCCGTC
GGCCGTTGACGATGGCGAGCTGATGGAAGCTTTCCTGCGCGGCGCCGGCCTGCAGCATCTGCGTCTGGAC
CGCGCAGCGGCCGTGGCGCAGATGGAGGCTATCGGCCGCAGCTACCGGCTGATGGTCGAGGGACTGATCG
ACGTGTTGCGCGCCCGTGCCAGCCTCAAGGGCGAGTTCCGCATGGCGCAGACCATGATCCAGCCGGTGCA
GAACAACCCGCTGAAGTTCGCGCCCAACGTCGACGAAGCGCTGCTCATGTTGCTGCGTCACGACAACCAG
GCGTTCATGGCGCCGGACCAGGCGGTGGGCGAGAGTTTCGACGACCTGCGTGCCCACCAGCTGGCGCTGA
TGGCGGGCGTGCAGGCCGCCATCAAATATTTGCTCGCGCGCTTTGAACCGCGTGAGCTGGAAGGGCGTCT
GAACAAGCCGAGCGGGCTCTCGGCACTGCTGCCCAATGGCCGTCGGGCGCATTACTGGGAGCTGTTCACC
GAGCTGTACGCGACCATCTCCCAGGAGGCCGAGGACGGTTTCCAGGAGCTGTTCGGCCGTGAATTCAGCC
GCGCCTACGAAGAACACATTGCGAGATTGCGAGGCCGTTGA