SecReT6
Protein ID: 333898460
SecReT6 ID439
T6SS typei3
Gene symbol-
Locus tagPsefu_0255
StrainPseudomonas fulva 12-X
Repliconchromosome [GenBank: NC_015556] [Browse all T6SS(s) in this replicon]
Location [Strand]289039..289506 [+]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDF6AF41
KEGG IDpfv:Psefu_0255
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.60E-38, Aligned region: 11..146
LPAM_1 [PF08139], Evalue: 0.0099, Aligned region: 3..18
Protein Sequence: 155 a.a.     [Download]
>gi|333898460|ref|YP_004472333.1| type VI secretion lipoprotein [Pseudomonas fulva 12-X]
MPRILPLLVFVLLSACASGPKEPVPTTVELQLQASRDLNPALDSVASPVWVQIYQLRNASTFSRADFFSL
VDRADATLAGELIETERFVVRPGETQRKSLTLDDATRHLGVVVAYRALDRSIWRQVIEIPAHQASALRLQ
LDAYAISATPLTPLE
 
Nucleotide Sequence: 468 bp     [Download]
>gi|333898208|ref|NC_015556.1|:289039-289506 Pseudomonas fulva 12-X chromosome, complete genome
ATGCCAAGGATTTTGCCACTGCTGGTTTTCGTGTTGCTCAGCGCCTGCGCGTCGGGGCCGAAGGAGCCGG
TGCCCACCACCGTCGAGTTGCAGCTACAGGCCAGCCGCGACCTCAACCCGGCGCTCGACAGCGTAGCCTC
GCCGGTCTGGGTGCAGATCTACCAGCTGCGCAATGCCTCGACCTTTTCCCGTGCCGATTTCTTCTCGCTG
GTCGATCGCGCCGACGCCACCCTGGCTGGCGAGCTGATCGAAACCGAGCGTTTCGTGGTGCGCCCCGGCG
AAACCCAGCGCAAGTCACTGACCCTCGACGACGCTACCCGCCACCTCGGCGTGGTGGTGGCCTACCGCGC
CCTCGACCGTTCGATCTGGCGCCAGGTCATCGAAATTCCTGCCCATCAGGCCAGCGCCCTGCGCCTGCAG
CTGGACGCCTATGCCATCAGCGCCACGCCGCTGACCCCCCTTGAGTGA