SecReT6
Protein ID: 333898461
SecReT6 ID439
T6SS typei3
Gene symbol-
Locus tagPsefu_0256
StrainPseudomonas fulva 12-X
Repliconchromosome [GenBank: NC_015556] [Browse all T6SS(s) in this replicon]
Location [Strand]289521..290855 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDF6AF42
KEGG IDpfv:Psefu_0256
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 8.60E-159, Aligned region: 19..443
Protein Sequence: 444 a.a.     [Download]
>gi|333898461|ref|YP_004472334.1| type VI secretion protein [Pseudomonas fulva 12-X]
MSWNNRVVWSEGMFLRPQHFQQQDRYIETLVESRSHAVQPGAWGFSQLLIDSALLAQGKLAILSARGLLP
DGTPFNIPESDAAPAPLNIDENLRDGIVYLALPLRRAGLRDTVEAGEPLGSARYLSSVHEVRDDNSSLES
RAPVAIGSLALRLITERDGLDEHAAVGVVRVVEKREDRSLLLDDSYIPPLLDVSASRPLAGFRNELLGLL
HQRGEALAGRVVASGAGGASEIADFLLLQLVNRAQPLVAHLARIAPLHPEVLYRELVALAGEFSTFTAAE
RRPGEYPVYEHDDLTSTFAPVMLALRQALSMVIDSRAIPIPIVEKSYGVHVAMLADKSLLDSASFILVVR
ADVPGESLRGHFPQQAKIGSVEHIRDLVNLQLPGIGLLPLPVAPRQLPYHAGSNYFELDRGSDHWKQLIH
SGGFAFHIAGQFPGLNLAFWAIRG
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|333898208|ref|NC_015556.1|:289521-290855 Pseudomonas fulva 12-X chromosome, complete genome
ATGTCCTGGAACAATCGTGTGGTTTGGTCGGAGGGAATGTTCCTGCGACCGCAGCACTTCCAGCAGCAGG
ATCGCTATATCGAAACCCTGGTCGAAAGCCGCAGCCATGCCGTGCAGCCCGGCGCCTGGGGCTTTTCCCA
ACTGCTGATCGACAGCGCCCTGCTGGCCCAGGGCAAGCTGGCGATCCTCTCGGCGCGCGGCCTGCTGCCG
GACGGCACGCCCTTCAACATTCCCGAGAGCGACGCCGCGCCGGCGCCCTTGAACATCGATGAGAACCTGC
GCGACGGCATCGTCTACCTGGCCCTGCCGCTGCGCCGTGCCGGCCTGCGCGACACCGTGGAAGCCGGCGA
GCCGCTCGGCTCGGCGCGCTACCTGAGCAGCGTGCATGAAGTGCGTGACGACAACTCCTCGCTGGAAAGC
CGCGCGCCGGTGGCCATCGGTTCCCTGGCACTGCGCCTGATCACCGAGCGTGACGGCCTCGACGAGCACG
CCGCCGTGGGCGTGGTGCGCGTGGTGGAAAAACGCGAGGACCGCAGCCTGCTGCTCGACGACAGCTACAT
TCCGCCGCTGCTCGACGTCAGTGCCTCGCGGCCGCTGGCCGGGTTTCGCAACGAACTGCTCGGCCTGCTG
CACCAGCGTGGTGAAGCCCTGGCCGGGCGGGTGGTCGCCTCCGGTGCCGGCGGCGCCTCGGAGATCGCCG
ATTTCCTGCTGCTGCAACTGGTCAACCGCGCCCAGCCGCTGGTCGCGCACCTGGCGCGCATCGCCCCGCT
GCACCCGGAAGTGCTGTACCGCGAACTGGTGGCCCTCGCCGGTGAATTCTCGACCTTCACCGCCGCCGAA
CGCCGGCCAGGCGAGTACCCGGTGTACGAACACGACGACCTGACCAGCACCTTCGCACCGGTGATGCTGG
CGTTGCGTCAGGCGCTATCGATGGTCATCGACAGCCGCGCGATCCCGATTCCCATCGTCGAGAAATCCTA
CGGCGTGCACGTGGCGATGCTCGCCGACAAATCGCTGCTCGACTCGGCCAGTTTCATCCTCGTGGTGCGC
GCCGACGTGCCGGGCGAGAGCCTGCGCGGGCATTTCCCGCAACAGGCCAAGATCGGCTCGGTGGAGCACA
TCCGCGACCTGGTCAACCTGCAGTTGCCGGGCATCGGCCTGCTGCCGCTACCGGTGGCGCCGCGCCAGCT
GCCGTACCACGCCGGTTCCAACTACTTCGAACTGGACCGGGGCAGCGATCACTGGAAGCAGCTGATCCAT
TCCGGCGGTTTCGCTTTCCATATCGCAGGCCAGTTCCCGGGCCTGAACCTGGCCTTCTGGGCCATCCGAG
GCTGA