SecReT6
Protein ID: 333898462
SecReT6 ID439
T6SS typei3
Gene symbol-
Locus tagPsefu_0257
StrainPseudomonas fulva 12-X
Repliconchromosome [GenBank: NC_015556] [Browse all T6SS(s) in this replicon]
Location [Strand]290862..292208 [+]
ProductDotU family type IV / VI secretion system protein
NoteTssL
UniProt IDF6AF43
KEGG IDpfv:Psefu_0257
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.20E-69, Aligned region: 65..270
OmpA [PF00691], Evalue: 2.30E-17, Aligned region: 338..436
Protein Sequence: 448 a.a.     [Download]
>gi|333898462|ref|YP_004472335.1| DotU family type IV / VI secretion system protein [Pseudomonas fulva 12-X]
MTIDDPFGALPGQPGKGSDPANDRTMIMPRPGGRAAEPARPAPAGSPPPAMPSAPPLAARGLGLNPIEAA
AGPMLALLTRLRSTISHPAPASLRAQLLGYLRQFEDKARAAGVAQDEVMLARYVLCTALDEAVMSTPWGS
SSDWSKQSLLITLHNEAWGGEKVFQLLDHCLQNPRQRLNLLELLYLCISLGMEGRYRVMQDGRSQLDALR
ERVAATIRSTRGEIERELSPHWRGLVVARDRLRQFLPPWVAVAIGLAILLVLLFGLRMKLAAEAEPVFRN
LHALGDVPVQTIDRPAQQPRIVERPRLAGFLAEEIRAQKVAVEDAVDRSVVTIRGDQLFASGSASIADDF
QPLLLRIAEAIRKVNGQVLVTGHSDNRPIATLRYPSNWKLSQDRAQQVMDVLVAKTGQPARFRAEGRSDT
EAVASNDTAEGRARNRRVEITVFAEGVE
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|333898208|ref|NC_015556.1|:290862-292208 Pseudomonas fulva 12-X chromosome, complete genome
ATGACCATCGACGATCCATTTGGCGCCTTGCCCGGCCAGCCCGGCAAGGGCAGTGACCCGGCTAACGACC
GCACCATGATCATGCCGCGCCCCGGTGGCCGTGCGGCCGAGCCTGCGCGCCCGGCACCTGCCGGCTCGCC
GCCGCCAGCCATGCCCAGCGCGCCGCCCCTGGCTGCCCGTGGCCTGGGCCTGAACCCCATCGAAGCCGCC
GCAGGTCCCATGCTGGCGCTGCTGACGCGCCTGCGCAGCACCATTTCCCATCCCGCGCCGGCCAGCCTGC
GCGCCCAGCTGCTCGGCTACCTGCGCCAGTTCGAGGACAAGGCCCGCGCCGCCGGGGTGGCCCAGGACGA
AGTGATGCTGGCGCGCTACGTGCTGTGCACCGCCCTGGACGAAGCGGTGATGAGCACGCCCTGGGGCAGC
AGCAGCGACTGGAGCAAGCAGAGCCTGCTGATCACCCTGCACAACGAGGCCTGGGGCGGCGAAAAGGTGT
TCCAGCTGCTCGACCACTGCCTGCAGAACCCGCGCCAGCGCCTCAACCTGCTGGAACTCCTGTACCTGTG
CATCAGCCTCGGCATGGAGGGACGCTACCGGGTCATGCAGGATGGTCGCAGCCAGCTCGACGCCTTGCGC
GAGCGGGTGGCGGCGACCATCCGCAGCACCCGTGGCGAAATCGAGCGCGAGCTGTCGCCGCACTGGCGCG
GCCTGGTGGTCGCCCGTGACCGGCTGCGCCAGTTCCTGCCGCCCTGGGTGGCGGTGGCCATCGGCCTGGC
GATCCTGCTGGTGCTGCTGTTCGGCCTGCGCATGAAGCTGGCCGCCGAGGCCGAGCCGGTGTTCCGCAAC
CTGCACGCTCTGGGTGATGTGCCGGTGCAGACCATCGACCGCCCGGCTCAGCAGCCACGCATCGTCGAGC
GCCCGCGCCTGGCCGGTTTCCTGGCCGAGGAAATTCGCGCGCAGAAAGTCGCGGTGGAAGATGCTGTCGA
CCGTTCGGTGGTGACCATCCGCGGCGACCAGTTGTTCGCCTCCGGCAGTGCATCGATTGCCGATGACTTC
CAGCCATTGCTGCTGCGTATCGCCGAAGCCATTCGCAAGGTCAACGGCCAGGTGCTGGTCACCGGCCACA
GCGACAACCGGCCCATCGCCACGCTGCGCTATCCGTCCAACTGGAAGCTCTCCCAGGACCGCGCCCAGCA
GGTGATGGACGTGCTGGTGGCCAAGACCGGCCAGCCCGCACGCTTCCGTGCCGAAGGGCGCAGCGATACC
GAGGCGGTGGCATCCAACGACACGGCAGAAGGCCGTGCGCGTAACCGCCGCGTGGAAATCACAGTTTTTG
CGGAGGGCGTCGAGTGA