SecReT6
Protein ID: 333898464
SecReT6 ID439
T6SS typei3
Gene symbol-
Locus tagPsefu_0259
StrainPseudomonas fulva 12-X
Repliconchromosome [GenBank: NC_015556] [Browse all T6SS(s) in this replicon]
Location [Strand]295720..296379 [+]
Producttype VI secretion system-associated protein
NoteTagF
UniProt IDF6AF45
KEGG IDpfv:Psefu_0259
PDB IDNA
Domain hit(s) vs Pfam DUF2094 [PF09867], Evalue: 1.50E-48, Aligned region: 5..142
Protein Sequence: 219 a.a.     [Download]
>gi|333898464|ref|YP_004472337.1| type VI secretion system-associated protein [Pseudomonas fulva 12-X]
MSTPGFYGKLAVRGDFIHRGLSPAFIEAWDAWLAAGLAASRQTLGEAWLDAYLVSPLWRFAVAPGLLGAE
PVCGVMMPSVDRVGRYFPLTIVLPLPADADIGQLVSGADDWFERAEGLLLSTLEEGADAEAFERGVEALG
SPLLTSCSEQRWDASGAAIWPASNPPARGLALMQQAWNGASLWWGNGSERVAPGLVRFAGLPPAEAFSRL
LSESAGGQP
 
Nucleotide Sequence: 660 bp     [Download]
>gi|333898208|ref|NC_015556.1|:295720-296379 Pseudomonas fulva 12-X chromosome, complete genome
GTGAGTACACCAGGTTTCTACGGCAAGTTGGCCGTACGGGGAGATTTCATTCATCGCGGCCTGAGCCCGG
CGTTCATCGAAGCCTGGGATGCCTGGCTGGCAGCGGGGCTGGCAGCCAGCCGGCAGACCCTTGGCGAAGC
CTGGCTGGACGCCTACCTGGTCAGCCCGCTGTGGCGTTTCGCCGTAGCGCCCGGCCTGCTTGGCGCCGAG
CCGGTATGCGGGGTGATGATGCCCAGCGTTGACCGGGTCGGCCGTTATTTCCCGCTGACCATCGTCCTGC
CGCTGCCAGCGGATGCCGACATCGGTCAGCTGGTCAGCGGCGCTGACGACTGGTTCGAGCGCGCCGAAGG
GCTGCTGCTGTCGACCCTGGAGGAGGGCGCCGATGCCGAGGCCTTCGAGCGCGGCGTCGAGGCGTTGGGC
AGCCCATTGCTGACCAGCTGCAGCGAACAGCGCTGGGACGCCAGCGGCGCCGCCATCTGGCCCGCGAGCA
ATCCGCCGGCACGTGGCCTGGCCCTGATGCAGCAGGCCTGGAACGGCGCCAGCCTGTGGTGGGGCAATGG
CTCCGAGCGCGTGGCGCCGGGGCTGGTGCGCTTCGCGGGGTTGCCGCCGGCCGAGGCATTCAGCCGCCTG
CTCAGCGAGTCCGCGGGAGGCCAGCCGTGA