SecReT6
Protein ID: 333898465
SecReT6 ID439
T6SS typei3
Gene symbol-
Locus tagPsefu_0260
StrainPseudomonas fulva 12-X
Repliconchromosome [GenBank: NC_015556] [Browse all T6SS(s) in this replicon]
Location [Strand]296376..297104 [+]
ProductSer/Thr phosphatase
NotePppA
UniProt IDF6AF46
KEGG IDpfv:Psefu_0260
PDB IDNA
Domain hit(s) vs Pfam PP2C_2 [PF13672], Evalue: 2.10E-16, Aligned region: 13..209
PP2C [PF00481], Evalue: 1.50E-10, Aligned region: 27..234
SpoIIE [PF07228], Evalue: 4.40E-07, Aligned region: 38..240
Protein Sequence: 242 a.a.     [Download]
>gi|333898465|ref|YP_004472338.1| protein serine/threonine phosphatase [Pseudomonas fulva 12-X]
MIPSNVTRYHSASHTHVGMVRKINEDACLDAPDNGLWAVADGMGGHASGDFVSSLIIDSLRALPPSAVLD
TYRGAIIDTLDQVNGQVRVEAEKRGGATMGSTVVVLAARGAEALCLWAGDSRLYRLRNGDLQPISRDHSY
VQELVDSGLLDDEAARSHPMGNIVTRALGVQDELELETATLEVRPGDTFLLCSDGLNKTVEDHELREVLG
HEDPYQVVRSLVHLGLTRGAPDNITAVVIKAA
 
Nucleotide Sequence: 729 bp     [Download]
>gi|333898208|ref|NC_015556.1|:296376-297104 Pseudomonas fulva 12-X chromosome, complete genome
GTGATTCCGTCGAACGTGACCCGCTACCACTCGGCCAGCCACACCCATGTCGGCATGGTGCGCAAGATCA
ACGAGGACGCCTGCCTGGACGCTCCGGACAACGGCCTGTGGGCCGTCGCCGACGGCATGGGCGGGCATGC
CAGCGGCGACTTCGTCAGCAGCCTGATCATCGACAGCCTGCGCGCCCTGCCGCCCAGTGCGGTGCTCGAC
ACCTACCGCGGGGCGATCATCGATACCCTGGATCAGGTCAACGGGCAGGTGCGCGTCGAAGCCGAGAAAC
GGGGGGGCGCGACCATGGGCAGCACCGTGGTGGTGCTCGCCGCCCGGGGCGCCGAGGCGCTCTGCCTGTG
GGCCGGCGACAGCCGCCTGTACCGGCTGCGCAACGGCGATCTGCAGCCGATCAGCCGTGACCACAGCTAC
GTGCAGGAACTGGTCGACAGCGGCCTGCTCGACGACGAAGCCGCGCGCAGCCACCCCATGGGCAACATCG
TCACCCGCGCCCTCGGCGTGCAGGACGAACTGGAGCTGGAAACCGCGACGCTGGAAGTGCGCCCCGGCGA
CACCTTCCTGCTGTGCAGCGACGGCCTGAACAAGACGGTCGAGGATCATGAACTGCGCGAAGTGCTGGGC
CACGAAGACCCCTACCAGGTGGTGCGCAGCCTGGTGCACCTTGGCTTGACCCGGGGCGCGCCGGATAATA
TTACCGCCGTGGTGATCAAGGCCGCGTAG