SecReT6
Protein ID: 333898466
SecReT6 ID439
T6SS typei3
Gene symbol-
Locus tagPsefu_0261
StrainPseudomonas fulva 12-X
Repliconchromosome [GenBank: NC_015556] [Browse all T6SS(s) in this replicon]
Location [Strand]297189..300221 [+]
Productserine/threonine protein kinase
NotePpkA
UniProt IDF6AF47
KEGG IDpfv:Psefu_0261
PDB IDNA
Domain hit(s) vs Pfam Pkinase [PF00069], Evalue: 2.10E-48, Aligned region: 8..250
Pkinase_Tyr [PF07714], Evalue: 1.30E-32, Aligned region: 10..248
VWA_2 [PF13519], Evalue: 9.80E-11, Aligned region: 118..168
VWA_2 [PF13519], Evalue: 9.80E-11, Aligned region: 333..426
VWA_2 [PF13519], Evalue: 9.80E-11, Aligned region: 595..772
VWA_2 [PF13519], Evalue: 9.80E-11, Aligned region: 850..872
APH [PF01636], Evalue: 3.30E-05, Aligned region: 12..95
APH [PF01636], Evalue: 3.30E-05, Aligned region: 120..151
APH [PF01636], Evalue: 3.30E-05, Aligned region: 233..268
Kinase-like [PF14531], Evalue: 0.00012, Aligned region: 79..97
Kinase-like [PF14531], Evalue: 0.00012, Aligned region: 121..212
Protein Sequence: 1010 a.a.     [Download]
>gi|333898466|ref|YP_004472339.1| serine/threonine protein kinase [Pseudomonas fulva 12-X]
MDMQIPGYDIERELGDGAMAVVYLATQRSLDRKVALKVMAASLAADPTFCERFLREGRTLARLSHPNTVT
IHDIGNVGSLYYMAMEYLPNGTLKERIAAGLSIDQGLVWIRQIASALGYAHAQGMVHRDVKPANILFRAD
GTAVLSDFGIAKALDDRTQFTQAGFAVGTPSYMSPEQARGLDIDGRADLYALGVVLYEILTGKLPYTGSD
SLSTALAHLTEPLPALPMVHGRYQPILERLLAKDPKERFADAAELIAALDRLESPTDDATLFQPLVLPEG
GKAGDISPPPLAPVTVDIPTHAPAAEPTAAPRPQPSPLASSVRQGNAGASKKPLILGVSLAGVLLLAGCG
YWLFGSDGTPSTAPPVAGQPAQSQTQSQALAQPSGEAGPISAAANSDGGDRPLLMPGKKTLFQRVLTKPG
AKLADAAGGSGGKDMPAFSVFYVYARQDIDGQPWLQIGASTDGRRDGWLPANAVSDWKQSLVLKFTERSG
RSPVMFVRDASALEQLLAEPARAREALREALKGTGHNVVAVEPGGSAVPQDQFYLLPIFDSEETFDANGQ
PLQLLNVASIDPGSAQQTGADSTPAAMPEGFRTAIVLVVDTSVSMQPYIDRVRDVVHELQGQIAKRGDLD
SVSFGMVGFRSNTSKTPGLEYTAKTLVSLEEGRDPQRFLQLAQQIKATDVSSHDFNEDAFAGVMQAVDGM
DWNGYGGRLILLVSDAGALRKSDPLGLTQMNEAEVREAALRKQIKIYALHLKTPAGKRNHGFAEQQYRTL
TADPNPRIGDLYVPVAGGDVNAFGQSVSQIGNAFADLVHKVRTDSRLPEPKGGSSIADKSAAVGYAMHMD
FLGHQSQARAPQVVTAWTSDRDITDPALPAFQVCVLLTKLQLNDLQQSLRMVVDAARRTQSSPKDFFQEI
ASASAHMSRDPSALVKGGNLAQSGVLGEYLDGLPYRSKVLNMSQDLWLSLSVAEQEDFIDELDSKIRLYE
TFHNDTANWVRFGDAAPGDALYRVPLSTLP
 
Nucleotide Sequence: 3033 bp     [Download]
>gi|333898208|ref|NC_015556.1|:297189-300221 Pseudomonas fulva 12-X chromosome, complete genome
ATGGATATGCAAATACCGGGTTACGACATCGAACGCGAGCTGGGCGATGGCGCGATGGCCGTGGTCTACC
TGGCGACCCAGCGCTCCCTTGACCGCAAGGTGGCGCTCAAGGTGATGGCCGCCTCGCTGGCTGCCGATCC
GACCTTCTGCGAGCGCTTTCTGCGCGAGGGCAGGACCCTGGCGCGGCTGTCGCACCCCAATACCGTGACC
ATCCACGACATCGGCAATGTCGGCAGCCTCTATTACATGGCCATGGAATACCTGCCGAACGGCACGCTCA
AGGAGCGCATCGCCGCGGGGCTGAGCATCGACCAGGGGCTGGTGTGGATCCGCCAGATCGCCTCGGCCCT
GGGGTATGCCCACGCCCAGGGCATGGTGCACCGCGACGTCAAGCCGGCCAACATCCTGTTCCGCGCCGAC
GGCACTGCGGTGCTCAGCGACTTCGGCATCGCCAAGGCGCTGGACGATCGCACCCAGTTCACCCAGGCCG
GCTTCGCCGTCGGCACGCCCAGCTACATGAGCCCCGAGCAGGCCCGCGGCCTGGATATCGATGGCCGCGC
CGACCTCTACGCCCTCGGTGTGGTGCTTTACGAAATTCTCACCGGCAAGCTGCCTTATACCGGCAGCGAT
TCGCTGTCCACGGCGCTGGCGCACCTGACCGAGCCGTTGCCGGCGCTGCCCATGGTGCATGGCCGCTATC
AGCCGATTCTCGAGCGTCTGCTGGCCAAGGATCCCAAGGAGCGCTTCGCCGACGCCGCCGAGCTGATCGC
CGCACTGGATCGCCTGGAGTCGCCCACCGACGATGCCACCCTGTTCCAGCCGCTGGTGCTGCCGGAGGGC
GGAAAAGCCGGCGACATCAGCCCTCCGCCCTTGGCGCCGGTGACCGTGGACATACCCACCCATGCACCCG
CCGCCGAGCCCACGGCAGCGCCGCGCCCGCAGCCGTCGCCGCTGGCCTCTTCGGTACGCCAGGGCAATGC
CGGTGCGAGCAAGAAGCCGCTGATTCTCGGCGTTTCGCTTGCGGGCGTGCTGTTGCTGGCCGGTTGCGGC
TACTGGCTGTTCGGCTCCGATGGCACGCCGTCCACTGCGCCGCCGGTGGCCGGTCAGCCGGCCCAGAGCC
AGACTCAGTCCCAGGCACTGGCTCAGCCCAGCGGCGAGGCCGGGCCGATCTCGGCGGCGGCCAACAGCGA
CGGCGGTGATCGCCCGCTGCTGATGCCCGGCAAGAAGACCCTGTTCCAACGCGTGCTGACCAAGCCAGGC
GCCAAGCTCGCCGATGCGGCTGGCGGCAGCGGTGGCAAGGACATGCCGGCGTTCTCGGTGTTCTACGTCT
ACGCCCGCCAGGACATCGACGGCCAGCCCTGGCTGCAGATCGGCGCGTCCACCGATGGCCGCCGTGACGG
TTGGCTGCCGGCCAATGCGGTCAGCGACTGGAAGCAGAGCCTGGTGCTCAAGTTCACCGAACGCTCCGGC
CGCTCGCCGGTGATGTTCGTGCGTGACGCCTCGGCCCTGGAGCAGCTGCTGGCCGAGCCGGCGCGGGCCC
GTGAAGCCCTGCGCGAGGCGCTCAAGGGCACCGGCCACAATGTGGTGGCGGTCGAGCCCGGCGGCAGCGC
CGTGCCCCAGGACCAGTTCTACCTGTTGCCGATCTTCGACTCCGAAGAAACCTTCGACGCCAACGGCCAG
CCGCTGCAGTTGCTCAACGTCGCCTCCATCGATCCGGGCAGCGCGCAGCAAACCGGGGCCGACAGTACGC
CCGCGGCGATGCCGGAAGGCTTCAGAACGGCCATCGTGCTGGTGGTCGACACCTCGGTGTCGATGCAGCC
CTACATCGACCGCGTGCGCGACGTGGTGCACGAACTGCAGGGGCAGATAGCCAAGCGCGGCGACCTGGAC
AGCGTCAGCTTCGGCATGGTGGGCTTTCGCAGCAACACCAGCAAGACGCCGGGCCTGGAGTACACCGCCA
AGACCCTGGTCAGCCTGGAGGAGGGCCGCGATCCTCAGCGCTTCCTGCAACTGGCGCAGCAGATCAAGGC
CACCGACGTATCCAGCCACGACTTCAACGAGGACGCCTTCGCCGGCGTCATGCAGGCGGTCGACGGCATG
GACTGGAATGGCTATGGCGGCCGCCTGATCCTGCTGGTCAGCGATGCCGGCGCGCTGCGCAAGAGCGACC
CGCTGGGCCTGACCCAGATGAACGAGGCCGAAGTACGCGAGGCCGCCCTGCGCAAGCAGATCAAGATCTA
CGCGCTGCACCTGAAAACCCCGGCCGGCAAGCGCAACCATGGCTTCGCCGAGCAGCAGTACCGCACTCTT
ACCGCCGACCCCAACCCGCGCATCGGCGACCTGTACGTGCCGGTGGCCGGCGGCGACGTCAATGCCTTCG
GGCAGAGCGTGTCGCAGATCGGCAACGCCTTCGCCGACCTGGTGCACAAGGTGCGCACCGACAGCCGCCT
GCCCGAGCCCAAGGGCGGTTCGAGCATCGCCGACAAGTCGGCGGCGGTCGGTTACGCCATGCACATGGAT
TTCCTCGGCCACCAGAGCCAGGCCCGCGCGCCCCAGGTGGTCACCGCCTGGACCAGCGACCGCGACATCA
CCGACCCGGCGCTGCCGGCCTTCCAGGTCTGCGTGCTGCTCACCAAATTGCAGCTCAACGACCTGCAGCA
GTCGTTGCGCATGGTGGTCGACGCGGCGCGCCGTACCCAGAGCTCGCCCAAGGATTTCTTCCAGGAAATC
GCCAGCGCCAGTGCGCATATGAGCCGCGACCCCTCGGCGCTGGTCAAGGGCGGCAATCTGGCGCAGAGCG
GCGTGCTCGGCGAATACCTGGACGGCCTGCCGTACCGCAGCAAGGTGCTGAATATGAGCCAGGACCTGTG
GCTGTCGCTCAGCGTCGCCGAGCAGGAAGATTTCATCGACGAGCTGGACTCCAAGATCCGCCTCTATGAA
ACCTTCCACAACGACACGGCCAACTGGGTTCGCTTCGGCGATGCCGCCCCCGGCGACGCGCTGTACCGCG
TGCCCTTGTCGACGTTGCCCTGA