SecReT6
Protein ID: 333907038
SecReT6 ID440
T6SS typei5
Gene symbol-
Locus tagMar181_0649
StrainMarinomonas posidonica IVIA-Po-181
Repliconchromosome [GenBank: NC_015559] [Browse all T6SS(s) in this replicon]
Location [Strand]708321..710384 [+]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDF6D0Y2
KEGG IDmpc:Mar181_0649
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.10E-39, Aligned region: 47..335
Phage_base_V [PF04717], Evalue: 2.60E-24, Aligned region: 368..459
Glycohydro_20b2 [PF14845], Evalue: 0.0042, Aligned region: 464..567
Protein Sequence: 687 a.a.     [Download]
>gi|333907038|ref|YP_004480624.1| ImpA family type VI secretion-associated protein [Marinomonas posidonica IVIA-Po-181]
MSQLADPEYSNLVVIDSDGDEYVCTSLSVRESVNGISDIKALVQVSSGTPNSWVGTAVECAVYLELGSGR
SANRQYKGYVVSAKSQSQVADSSYFTMELHIQPWLGLLAYGKSCRVFQEQTVQAIVTSIFDEIGFSGDYS
VNSMPSSIREYCIQFNESDLDFVLRLLAEEGVHFYYDKNDGSSTLKLQDASKPFSSDEVISLDHVSSPGG
DNEVVKEWAYQNQFHSASLEIANFDYTQSKLVTSGVKSSQYSISGNTKLTNYRYPVAAATGDYSDLSGTQ
ITIQRAQLDSGYSRVYGETESMDLAVGFYLEMASHPDSAQEGKLLVIEAEHDFQSAPGSTFTHNTRFVGM
PEDALFYPSHRPKPVVHGLQSALVSGQTTGEPSCDESGRLRIKFHWDEETGDETSCYVRVAQPMAGSGYG
FQFLPRAGHEVLVSFINGDPDQPVIVSSVYNSTYKPPYATASTTQSGIKTKLAGEANELRFDDKKDNESF
YMHAAKDFLHEVVNDHTETIAGEKKTTVTKSITEAVTEKYTLSSKDNMALSTDKAYTLSATDSISEDSEK
ITLTATDTLKLVVGDSSITIKSDSIDISSSSITLNGDSDITLNGGDISQSGGSFSVDSDGSASISSGSSM
SLSAGSSLTAEASSSTSISGLNVTISADVSATVSGSASAEISSDGSTTVSGSIVMVN
 
Nucleotide Sequence: 2064 bp     [Download]
>ref|NC_015559.1|:708321-710384 ImpA family type VI secretion-associated protein [Marinomonas posidonica IVIA-Po-181]
ATGAGTCAGCTTGCAGATCCAGAGTACAGCAACCTAGTTGTGATCGATAGTGATGGCGATGAATACGTAT
GTACTTCATTGTCAGTGCGTGAATCGGTTAATGGTATCAGCGACATAAAAGCACTTGTTCAAGTCTCTTC
AGGAACGCCTAATAGCTGGGTGGGTACGGCAGTCGAATGCGCTGTGTATTTAGAGCTAGGATCAGGTCGT
TCAGCAAATAGACAATATAAAGGCTATGTTGTTTCTGCAAAAAGCCAATCTCAGGTGGCTGATTCTAGCT
ATTTCACTATGGAGTTGCACATTCAGCCTTGGTTGGGATTGCTTGCCTACGGGAAAAGTTGTCGCGTATT
TCAGGAGCAAACTGTACAAGCTATAGTGACATCTATCTTCGATGAAATAGGTTTTAGTGGTGATTACAGC
GTTAACAGTATGCCTTCTTCGATTCGGGAATATTGCATTCAGTTTAACGAGTCTGATTTGGATTTTGTGT
TGCGACTGCTTGCTGAGGAAGGCGTTCATTTTTATTACGATAAAAATGATGGTTCTTCGACGTTGAAGCT
ACAGGATGCTTCTAAGCCATTTAGCAGTGATGAAGTCATTTCTTTGGATCATGTATCATCACCGGGTGGT
GATAATGAAGTGGTGAAAGAGTGGGCTTATCAGAATCAATTTCATAGCGCTTCTTTGGAAATCGCAAATT
TTGATTACACTCAGTCAAAATTAGTGACCAGTGGGGTTAAAAGTTCTCAATATTCTATTTCAGGAAACAC
CAAGTTAACCAATTACCGGTATCCTGTGGCTGCAGCAACAGGTGATTACTCCGATCTCTCTGGGACACAA
ATAACGATCCAAAGAGCCCAACTAGATTCAGGCTACAGTCGTGTTTACGGTGAAACTGAGTCTATGGATT
TGGCTGTAGGCTTCTATTTAGAGATGGCATCTCATCCTGATAGTGCTCAGGAAGGAAAGCTCCTTGTTAT
TGAAGCGGAGCATGATTTTCAGTCTGCGCCAGGCTCTACCTTTACCCATAATACTCGCTTTGTTGGCATG
CCAGAAGATGCTCTATTTTACCCAAGTCACCGCCCTAAACCTGTCGTACATGGGTTGCAATCTGCGCTAG
TGTCTGGTCAAACCACTGGTGAGCCATCTTGCGATGAGTCAGGTCGACTCAGAATTAAATTCCATTGGGA
CGAAGAAACGGGTGATGAAACAAGCTGTTATGTGCGAGTAGCGCAACCTATGGCGGGCAGTGGTTATGGC
TTTCAATTTTTGCCTCGTGCCGGGCATGAAGTGTTAGTGAGCTTTATTAATGGTGACCCGGATCAGCCTG
TGATTGTCTCAAGTGTTTATAACAGCACTTATAAACCACCTTACGCCACGGCCAGTACTACGCAAAGTGG
CATTAAAACGAAGTTGGCCGGTGAAGCTAATGAGTTAAGGTTTGATGACAAAAAGGACAATGAGTCTTTT
TACATGCATGCCGCGAAAGATTTTCTGCATGAGGTGGTAAATGATCATACTGAGACCATTGCTGGTGAGA
AAAAGACCACTGTAACTAAGAGTATTACCGAAGCGGTAACTGAGAAGTATACGCTGTCTTCCAAGGATAA
TATGGCCTTGTCTACGGACAAGGCTTATACCTTAAGCGCCACGGACTCTATATCAGAGGACAGTGAAAAG
ATTACCTTAACCGCTACAGACACATTGAAATTGGTCGTGGGCGATAGCTCTATAACGATTAAAAGTGACT
CTATCGATATTAGCAGTAGCTCTATCACTTTAAATGGAGATTCGGATATTACCTTAAACGGAGGAGATAT
CAGCCAGTCTGGAGGTTCATTTAGTGTGGATTCAGATGGTTCTGCCAGTATAAGTTCAGGGAGTTCAATG
AGCCTAAGTGCAGGAAGTTCTTTAACCGCAGAGGCATCCAGCAGTACATCAATATCAGGATTGAATGTAA
CTATTTCAGCGGATGTTAGTGCGACGGTATCAGGTAGTGCTTCGGCAGAGATATCTTCAGATGGGTCGAC
GACTGTTAGTGGCAGCATTGTGATGGTGAACTAG