SecReT6
Protein ID: 333907042
SecReT6 ID440
T6SS typei5
Gene symbol-
Locus tagMar181_0653
StrainMarinomonas posidonica IVIA-Po-181
Repliconchromosome [GenBank: NC_015559] [Browse all T6SS(s) in this replicon]
Location [Strand]712443..713726 [+]
Producthypothetical protein
NoteTssA
UniProt IDF6D0Y6
KEGG IDmpc:Mar181_0653
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.40E-10, Aligned region: 62..123
Protein Sequence: 427 a.a.     [Download]
>gi|333907042|ref|YP_004480628.1| hypothetical protein Mar181_0653 [Marinomonas posidonica IVIA-Po-181]
MLEELVVPISDEAPCGEYLKDNRSVYRSYRNAFNMAQSSFRQLIEDPDALNNNELVEANAENWALLSSEC
ENCLKTVSKDIEIFCWHAVSQLFSRKPLENLQHSLETLDYLVTNDWANLQPMSPEEKLKAEDDAGKQREW
AEGRVKPLVQLVGDTAESGLLYMPLQMLTLVADIDYGKFFLAEKSGTLADLKSQALGALSSERAEVTERI
LSLGKIYETLVSIEKKVAEECNRVAAQGISFRFVKESVDRLLKTLRYLVEEGLPRWPLDPEEVGIEDNQP
EVETLASSEEPITNGESVQTASGGMAMTGVGIVASREQALAELQKIAEYFLQAEPHSPIYMLLKRAIRWG
HMPLPELLEELIGDNAVVQSRITQLAGLESAEHTVNFKASPEVTYTATSTPTPAAEKAKEPSVSPTNDVG
TLTGIEW
 
Nucleotide Sequence: 1284 bp     [Download]
>ref|NC_015559.1|:712443-713726 hypothetical protein Mar181_0653 [Marinomonas posidonica IVIA-Po-181]
ATGCTTGAAGAACTGGTCGTGCCTATTTCAGATGAAGCTCCCTGCGGTGAATATCTAAAGGATAATCGCT
CTGTTTATCGAAGCTATCGTAACGCTTTTAATATGGCCCAATCTTCTTTTCGTCAATTGATTGAGGATCC
AGATGCCTTAAATAACAATGAACTGGTTGAAGCCAATGCTGAAAACTGGGCTTTGCTTTCGAGTGAATGT
GAAAATTGTTTAAAGACGGTTTCGAAGGATATTGAAATATTTTGCTGGCATGCGGTGTCTCAACTGTTTT
CAAGGAAGCCGCTAGAGAATTTACAACATTCTTTAGAAACACTTGATTATTTAGTGACGAATGATTGGGC
AAACCTCCAACCAATGTCTCCTGAAGAAAAGTTAAAAGCAGAGGACGACGCTGGAAAACAAAGGGAATGG
GCTGAAGGTCGTGTTAAGCCTTTGGTTCAATTGGTTGGCGATACGGCAGAAAGTGGTTTGTTGTATATGC
CGTTGCAGATGTTGACCTTGGTTGCTGATATCGATTACGGAAAGTTCTTTTTGGCTGAAAAATCAGGAAC
CCTAGCGGATTTGAAATCTCAGGCATTAGGTGCTCTATCTAGTGAACGAGCTGAGGTGACCGAGCGTATT
TTATCGCTAGGTAAAATTTATGAAACTCTTGTTTCTATTGAGAAAAAAGTTGCTGAAGAGTGCAATCGTG
TTGCTGCTCAAGGGATTAGTTTTCGCTTTGTAAAAGAAAGTGTCGATCGTTTATTGAAAACGTTGCGCTA
TCTAGTAGAAGAAGGCTTACCTCGTTGGCCTTTGGATCCTGAAGAAGTTGGGATTGAAGATAATCAACCT
GAAGTGGAGACCCTTGCCTCATCCGAAGAGCCTATTACCAATGGCGAGAGTGTGCAAACAGCGTCAGGGG
GAATGGCGATGACAGGAGTCGGTATTGTGGCTAGCCGTGAGCAAGCATTAGCAGAATTGCAAAAAATTGC
TGAATATTTTTTGCAGGCAGAACCGCATAGCCCAATTTACATGCTGTTAAAACGAGCGATCAGATGGGGA
CATATGCCTCTTCCTGAATTATTAGAAGAACTTATTGGTGATAATGCCGTAGTGCAGTCACGCATTACTC
AATTAGCCGGTTTAGAAAGCGCCGAACATACAGTGAATTTTAAAGCATCCCCGGAGGTGACGTATACGGC
AACATCGACCCCCACTCCCGCGGCTGAAAAGGCAAAAGAACCAAGTGTAAGCCCCACGAATGATGTGGGA
ACGTTAACTGGTATTGAATGGTAA