SecReT6
Protein ID: 333907043
SecReT6 ID440
T6SS typei5
Gene symbol-
Locus tagMar181_0654
StrainMarinomonas posidonica IVIA-Po-181
Repliconchromosome [GenBank: NC_015559] [Browse all T6SS(s) in this replicon]
Location [Strand]713783..714307 [+]
Producthypothetical protein
NoteTssD
UniProt IDF6D0Y7
KEGG IDmpc:Mar181_0654
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.20E-24, Aligned region: 5..145
Protein Sequence: 174 a.a.     [Download]
>gi|333907043|ref|YP_004480629.1| hypothetical protein Mar181_0654 [Marinomonas posidonica IVIA-Po-181]
MASIYMRIDGLDDIKGAATVGEIGGKKGFFAIDNMHWGANRGVSVDVGNANNADKGMVSLDAIGISRVSD
GASPHLTTFLFAPGAEGKTVDILLTKPSRDGAGADPYLVITLEKARLSSYNVSGSDGNLPSEDMSLTYTA
LTLVYYNEGDGGKIEKGDTVKFDCTTGKLESKAG
 
Nucleotide Sequence: 525 bp     [Download]
>ref|NC_015559.1|:713783-714307 hypothetical protein Mar181_0654 [Marinomonas posidonica IVIA-Po-181]
ATGGCTTCTATTTATATGAGAATTGATGGTCTTGACGATATCAAAGGCGCTGCTACTGTTGGGGAAATCG
GCGGTAAAAAAGGTTTTTTTGCTATCGATAATATGCATTGGGGTGCCAACCGTGGTGTGTCTGTTGATGT
AGGTAATGCGAACAATGCTGATAAAGGTATGGTGTCTTTGGATGCCATTGGTATCTCTCGAGTATCTGAT
GGCGCTTCCCCTCACCTAACGACGTTTTTGTTTGCACCGGGTGCGGAAGGTAAGACAGTGGATATTTTGT
TAACTAAACCTTCTCGTGATGGCGCTGGTGCAGACCCTTACCTTGTTATTACTTTAGAGAAAGCACGCCT
TTCTAGCTACAATGTATCAGGTTCAGATGGCAATCTGCCGTCAGAAGACATGTCTTTGACTTATACCGCA
TTGACTTTGGTTTATTACAACGAAGGTGATGGCGGTAAGATTGAGAAGGGCGACACAGTTAAGTTTGATT
GCACTACAGGCAAGCTTGAGTCTAAAGCAGGTTAA