SecReT6
Protein ID: 333907044
SecReT6 ID440
T6SS typei5
Gene symbol-
Locus tagMar181_0655
StrainMarinomonas posidonica IVIA-Po-181
Repliconchromosome [GenBank: NC_015559] [Browse all T6SS(s) in this replicon]
Location [Strand]714336..714839 [+]
Producttype VI secretion lipoprotein
NoteTssB
UniProt IDF6D0Y8
KEGG IDmpc:Mar181_0655
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.30E-54, Aligned region: 7..160
Protein Sequence: 167 a.a.     [Download]
>gi|333907044|ref|YP_004480630.1| type VI secretion lipoprotein [Marinomonas posidonica IVIA-Po-181]
MALNSQHKRVSKNRVSITYDVETNGAVENKELPFVVGVLGDFSAHREDREDLEDRTFYQIDKDNFDTVMK
RVGPELKLKVDNTLSDDDSQFEAALKFSSMKDFEPDALIDQVEPLRKLAETRQQLKTLLSKADRSRDLEK
LLKEVLQSADTINALSGELGIEAKGDE
 
Nucleotide Sequence: 504 bp     [Download]
>ref|NC_015559.1|:714336-714839 type VI secretion lipoprotein [Marinomonas posidonica IVIA-Po-181]
GTGGCTTTGAATTCGCAACATAAGCGTGTAAGTAAAAACCGAGTCAGCATCACTTATGATGTTGAAACAA
ATGGAGCAGTAGAAAATAAAGAGTTGCCTTTCGTTGTAGGGGTACTTGGAGATTTTTCTGCTCACAGAGA
AGATCGTGAAGATCTTGAAGATCGCACTTTTTATCAGATAGATAAGGATAACTTTGACACTGTAATGAAG
CGCGTTGGTCCAGAGTTGAAACTTAAGGTAGATAACACCTTATCGGATGATGATAGCCAGTTTGAAGCTG
CGTTGAAGTTCTCCTCTATGAAGGATTTTGAACCAGATGCTTTGATAGATCAGGTTGAGCCCCTTAGAAA
ACTGGCCGAAACACGCCAGCAATTGAAAACTTTGTTATCTAAAGCCGACAGATCTCGCGATCTTGAGAAG
TTGCTGAAAGAAGTTCTGCAAAGTGCAGATACCATTAACGCGCTTTCAGGTGAGCTGGGAATTGAAGCTA
AGGGAGACGAATAA