SecReT6
Protein ID: 333907045
SecReT6 ID440
T6SS typei5
Gene symbol-
Locus tagMar181_0656
StrainMarinomonas posidonica IVIA-Po-181
Repliconchromosome [GenBank: NC_015559] [Browse all T6SS(s) in this replicon]
Location [Strand]714839..716317 [+]
Producttype VI secretion lipoprotein
NoteTssC
UniProt IDF6D0Y9
KEGG IDmpc:Mar181_0656
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 8.50E-164, Aligned region: 62..491
Protein Sequence: 492 a.a.     [Download]
>gi|333907045|ref|YP_004480631.1| type VI secretion lipoprotein [Marinomonas posidonica IVIA-Po-181]
MSAELENQAAGEAEAGTLSFLDRAISATTQTPADTTKELFSVLAEQALGGTVVWDKNVTKTIENAIAEID
KQMSLQMSTIMQNDEFRRLEGSWRGLGKLVRESETGQSLKIKLVDFNKDELLSQFEDAPAVDRSPLFDAL
YQKEFGTAGGEPYGLLVGDYTFSHKDDDVALLRYMGETAAASHAPFIAAANPEMFEFDSFETFNEGKPVA
SGFDSPSYASWNAFRASDDARYVSLTLPQTLARLPYGKKGLGTDAFDYEELNVDSDGNPLPRDNSQLVWS
NAAFDLGLKMTQAHTAFGWCTAIRGLDNGGKVENLPNLTYKSLAGDLQQQCPIEVNLTDEREKELSDLGF
LPLVHYKNTNYGVFIGSQTTQKPKVFADPDATSNAAISARLPYIMASSRIAHYLKVMGRDMLGSNLEAND
IQKDLQTWIDQYTNSGAVGNAERSKTPLCESRIQVVEQPGRPGAYSAVAHLRPWLQLEELTTSVRMVTKI
PG
 
Nucleotide Sequence: 1479 bp     [Download]
>ref|NC_015559.1|:714839-716317 type VI secretion lipoprotein [Marinomonas posidonica IVIA-Po-181]
ATGAGTGCTGAATTAGAAAATCAAGCCGCTGGTGAAGCTGAAGCTGGGACATTAAGTTTTCTTGATAGAG
CCATTTCTGCGACCACTCAAACACCCGCTGATACTACTAAAGAGCTATTCTCTGTATTGGCTGAGCAAGC
GTTAGGCGGTACCGTTGTTTGGGATAAAAATGTTACTAAGACGATTGAAAATGCTATTGCTGAAATTGAT
AAGCAAATGTCTCTTCAGATGTCTACTATCATGCAAAATGATGAGTTTCGTCGCTTAGAAGGCTCTTGGA
GAGGTTTGGGTAAATTAGTTCGTGAAAGTGAGACTGGCCAAAGTTTGAAAATCAAATTGGTCGATTTTAA
CAAAGATGAATTATTGAGTCAGTTTGAAGACGCTCCAGCTGTGGATCGTAGCCCTCTGTTTGATGCTCTT
TATCAAAAAGAATTTGGCACAGCGGGTGGTGAGCCTTATGGATTGTTAGTTGGTGACTATACCTTCTCTC
ATAAGGATGATGATGTTGCATTATTGCGTTATATGGGTGAGACGGCTGCAGCCAGTCACGCTCCTTTTAT
CGCCGCTGCTAATCCTGAGATGTTTGAGTTTGATTCCTTCGAGACTTTTAATGAAGGCAAGCCTGTTGCT
TCAGGTTTTGATTCTCCTTCTTATGCTTCTTGGAATGCTTTCCGCGCTAGTGATGATGCTCGCTATGTTA
GTTTGACATTACCTCAAACACTTGCTCGTCTTCCCTATGGTAAAAAGGGATTGGGTACGGATGCCTTTGA
TTATGAAGAGTTGAATGTAGACTCTGATGGCAACCCATTGCCAAGAGATAACTCGCAATTAGTATGGTCA
AATGCCGCATTTGATTTGGGTCTTAAAATGACTCAAGCCCATACTGCTTTTGGTTGGTGTACTGCTATTC
GTGGTTTGGATAACGGTGGTAAGGTTGAAAACCTACCCAACTTAACTTACAAGTCTTTAGCTGGTGATCT
ACAGCAACAATGTCCTATCGAAGTTAACTTAACGGATGAGCGTGAGAAAGAGTTAAGTGATTTAGGATTC
TTGCCATTGGTTCACTATAAAAACACCAATTATGGTGTATTTATTGGTAGCCAAACCACTCAAAAACCGA
AAGTCTTTGCTGATCCAGACGCAACAAGTAATGCCGCTATTTCTGCTCGCTTACCATATATCATGGCAAG
TAGCCGTATTGCGCATTATTTGAAAGTAATGGGGCGCGACATGCTTGGTTCTAACTTGGAGGCAAATGAC
ATTCAGAAGGATCTTCAAACCTGGATTGATCAATACACCAACTCTGGTGCGGTTGGTAATGCAGAGCGAT
CTAAAACACCACTTTGTGAGTCTCGTATTCAAGTTGTTGAGCAACCTGGCCGTCCTGGTGCTTATTCTGC
CGTTGCGCACCTTCGCCCTTGGTTGCAACTTGAAGAATTGACGACGTCTGTACGCATGGTTACTAAGATT
CCTGGTTAG