SecReT6
Protein ID: 333907046
SecReT6 ID440
T6SS typei5
Gene symbol-
Locus tagMar181_0657
StrainMarinomonas posidonica IVIA-Po-181
Repliconchromosome [GenBank: NC_015559] [Browse all T6SS(s) in this replicon]
Location [Strand]716367..717794 [+]
Producthypothetical protein
NoteTssC
UniProt IDF6D0Z0
KEGG IDmpc:Mar181_0657
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.20E-119, Aligned region: 49..463
Protein Sequence: 475 a.a.     [Download]
>gi|333907046|ref|YP_004480632.1| hypothetical protein Mar181_0657 [Marinomonas posidonica IVIA-Po-181]
MQMLLSSIQDRLIQLDEDQGDYLISALTLLAELDDEMLLSKSALFASVSRLIAEIDENLSAQTSAILHHS
DFEALESVWLGVDSLVRLPVNNQKVKVRILDLSWDAVSQDVNNSISLRRSMLYNLIGNRELNTSGGQPFG
MVVVDRGISMDLDQDYDDVYTLELLGRLGDICLCPFIFSLADDFFGEKGADWISDIGRIEKILEGPEFTT
WRHLRSLPEARFIGLVMPRIKLRDSYTQESCRRFIFDETCRKQRGLWGHSAFMFASIAMREFNRINWFGF
MKSRWQDQYSGALVNVPENGIGSFSTKKPTPDVRIITEIGSFYSAQGFVPLCHSVMTEKYFFRGNSSIWK
SGKESAEAVMGQLQTTLMICRIAHYLKVQIRGMIGNFQTAEECELYLNNWLDRYSSNLFSADEVTLAKYP
LSKGVVKVREIPGQQGRYTCDVLVQPQYQFDNVCGEVLLSTDLGSERGASSEALA
 
Nucleotide Sequence: 1428 bp     [Download]
>ref|NC_015559.1|:716367-717794 hypothetical protein Mar181_0657 [Marinomonas posidonica IVIA-Po-181]
ATGCAAATGTTGTTGAGTTCGATACAGGATAGGTTAATTCAGTTAGATGAAGATCAAGGCGATTATTTAA
TAAGTGCTTTGACTTTATTGGCAGAATTGGATGACGAGATGCTATTAAGCAAAAGTGCTTTATTTGCGTC
AGTAAGTCGTTTAATTGCTGAGATTGATGAAAACCTGTCTGCTCAGACTTCAGCAATATTGCACCACTCT
GATTTTGAGGCGTTAGAATCCGTTTGGCTTGGTGTCGATTCACTGGTCAGGCTGCCTGTTAATAACCAGA
AAGTGAAAGTACGTATTTTGGATCTATCTTGGGATGCAGTATCACAAGATGTTAATAACTCGATCTCCTT
GCGCCGTTCAATGCTTTATAACCTGATTGGTAATAGAGAGCTAAATACGTCTGGTGGCCAACCGTTCGGC
ATGGTGGTGGTTGATCGTGGTATCTCGATGGATTTAGATCAAGATTACGATGATGTCTATACCCTTGAGC
TACTTGGGCGTCTAGGTGATATATGTCTTTGCCCATTTATTTTCTCGTTGGCGGATGATTTTTTTGGTGA
AAAAGGGGCCGATTGGATATCCGATATCGGACGTATCGAAAAAATCTTAGAAGGGCCCGAATTTACTACT
TGGAGGCATTTAAGGTCTCTACCAGAAGCTCGTTTTATTGGTTTGGTTATGCCTCGTATTAAGCTTAGAG
ATTCTTATACTCAAGAGTCTTGTCGGCGTTTCATTTTTGATGAAACCTGTCGTAAACAGAGAGGTCTCTG
GGGCCATTCTGCTTTTATGTTTGCCTCTATTGCGATGCGGGAATTTAACCGAATTAATTGGTTTGGTTTT
ATGAAGTCTCGCTGGCAGGACCAATACAGTGGAGCATTGGTTAATGTTCCTGAGAATGGTATTGGAAGTT
TCAGTACCAAAAAACCAACACCGGATGTTCGCATTATTACAGAAATTGGCAGCTTTTATTCTGCGCAGGG
CTTTGTTCCTTTGTGCCATAGCGTTATGACAGAAAAATATTTTTTCCGTGGTAATAGCTCTATCTGGAAG
TCAGGAAAAGAGAGTGCCGAAGCTGTAATGGGGCAGTTGCAAACAACTTTGATGATATGTCGTATTGCCC
ATTATTTGAAAGTTCAAATTCGCGGCATGATAGGGAATTTTCAAACGGCAGAAGAGTGTGAGTTATATCT
TAATAATTGGTTAGATCGCTACTCGAGTAATTTGTTTAGCGCCGATGAGGTGACATTAGCGAAATATCCT
CTAAGCAAAGGTGTGGTGAAAGTAAGAGAAATACCAGGTCAACAGGGGCGTTATACCTGCGATGTGCTTG
TTCAGCCACAGTATCAGTTTGATAATGTCTGCGGTGAAGTGTTGTTGTCGACAGATTTAGGTTCTGAAAG
GGGTGCAAGCTCAGAGGCTTTAGCATGA