SecReT6
Protein ID: 333907047
SecReT6 ID440
T6SS typei5
Gene symbol-
Locus tagMar181_0658
StrainMarinomonas posidonica IVIA-Po-181
Repliconchromosome [GenBank: NC_015559] [Browse all T6SS(s) in this replicon]
Location [Strand]717791..718213 [+]
ProductGPW/gp25 family protein
NoteTssE
UniProt IDF6D0Z1
KEGG IDmpc:Mar181_0658
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 5.20E-13, Aligned region: 16..113
Protein Sequence: 140 a.a.     [Download]
>gi|333907047|ref|YP_004480633.1| GPW/gp25 family protein [Marinomonas posidonica IVIA-Po-181]
MIFWNTFLKDEGSVGDEMLEAIRYQLTALLNSEAPMMNLPKGFKEIEASNMRFGLDSVYSISSQVDKDQF
ARSVEHWVRAFEPRLAEVSVFIEESDPQKNMICFSLMAKIKTPNGNHVFLFDSNISLSNQVAKLEGQEVV
 
Nucleotide Sequence: 423 bp     [Download]
>ref|NC_015559.1|:717791-718213 GPW/gp25 family protein [Marinomonas posidonica IVIA-Po-181]
ATGATATTTTGGAATACATTTCTAAAAGACGAGGGCTCAGTTGGCGATGAGATGTTGGAAGCTATACGTT
ATCAACTGACGGCTTTACTTAATTCTGAAGCACCAATGATGAATTTGCCAAAAGGCTTTAAGGAGATTGA
AGCGTCTAATATGCGTTTTGGTCTTGATAGTGTTTACAGTATTAGTAGTCAGGTGGATAAAGATCAATTT
GCTCGCTCTGTTGAGCATTGGGTGCGCGCTTTTGAACCACGTTTGGCTGAAGTGAGCGTCTTTATTGAAG
AAAGTGACCCACAAAAGAATATGATTTGTTTCTCGTTGATGGCGAAAATAAAAACACCAAATGGTAATCA
TGTTTTTTTGTTTGATTCGAATATTAGTTTATCGAATCAGGTGGCTAAATTAGAGGGTCAAGAAGTTGTC
TGA