SecReT6
Protein ID: 333907048
SecReT6 ID440
T6SS typei5
Gene symbol-
Locus tagMar181_0659
StrainMarinomonas posidonica IVIA-Po-181
Repliconchromosome [GenBank: NC_015559] [Browse all T6SS(s) in this replicon]
Location [Strand]718206..719984 [+]
Producttype VI secretion lipoprotein
NoteTssF
UniProt IDF6D0Z2
KEGG IDmpc:Mar181_0659
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.40E-128, Aligned region: 5..591
Protein Sequence: 592 a.a.     [Download]
>gi|333907048|ref|YP_004480634.1| type VI secretion lipoprotein [Marinomonas posidonica IVIA-Po-181]
MSDQLMRYFERELAYVRKSLNEFSGDFPEQANKLKLNQSSNEDPNISRLIDGMALLTAKTEKKIDDQFPE
VLQDLFNILYPGYLQISPSYAPIQLIEEPEKLSESIFLPKGNRLSVKLNKEQECIFTTVSDLTIDPYYIQ
NIKAEAAPFNFLTPANLRHADSVIQIELSCLDDDTFFSHFDLSHFDFYVRGFESNSKGLIDLLLLNTEII
SLLTPDGKLIEIDSSRLHSRIADTDFQWLPRHGSHFGGFDLLRDYFIYPDKAAYMRIAELGHELSKLNSS
KVTISLFTKQLPPEFLRLFNKKVFCLNTVPAINIFECRGEPIKYDFSKLSVPVIADLHSENEQTVVSVNT
VKEVLPTGEFELSPVYEGGYWHDESSPQWQSRQHWDEKGRRKVSLSISYPYSSQSKNSVVLATNLSVCNG
RLPCLIAANQPVELMASIELPGDLRVMSTPTAPQYPNLDNQLNWRFMALLNVNFSSLVQSDDTVKMLQES
LRMCSPNQTCSQADAIKQLEYKHLVAPMSIRQQSVFASGTEVTIMLDDEMLGNNIAILGEVLNQYFQQFC
SFDRFMQVKIKRFGNDAESIEYDKVHGSQLCL
 
Nucleotide Sequence: 1779 bp     [Download]
>ref|NC_015559.1|:718206-719984 type VI secretion lipoprotein [Marinomonas posidonica IVIA-Po-181]
TTGTCTGATCAATTGATGCGCTATTTCGAAAGAGAATTAGCCTATGTTCGTAAGTCGTTGAATGAATTTT
CTGGTGATTTTCCAGAACAAGCGAACAAACTTAAGTTAAATCAAAGTAGTAATGAAGACCCAAATATCAG
TCGATTGATTGATGGGATGGCATTGCTAACTGCAAAAACGGAAAAAAAGATCGATGATCAATTTCCTGAA
GTGCTGCAAGACTTATTTAATATTCTTTATCCAGGCTATCTTCAAATATCACCGAGTTACGCTCCAATTC
AGCTAATAGAAGAGCCAGAAAAGCTGAGCGAATCTATTTTTTTACCTAAAGGTAATCGACTGTCGGTTAA
GTTAAATAAAGAGCAAGAGTGTATTTTTACAACGGTCTCAGATCTCACGATAGACCCTTATTACATCCAA
AATATTAAGGCGGAAGCGGCTCCATTTAATTTTTTGACGCCAGCGAATCTTAGGCACGCAGATTCTGTGA
TACAGATTGAGCTGTCTTGTTTGGACGATGATACTTTTTTTAGCCATTTCGACTTAAGTCATTTCGATTT
TTATGTTCGTGGCTTTGAAAGTAACTCCAAAGGCTTAATTGACCTTCTACTATTGAATACCGAGATTATT
TCTTTGTTGACGCCAGATGGAAAACTCATAGAAATAGATTCATCGCGTTTGCATTCACGTATAGCGGATA
CTGACTTTCAATGGCTGCCTCGGCATGGGAGCCATTTTGGCGGTTTTGATTTGCTTAGAGACTACTTCAT
TTATCCAGATAAAGCTGCTTATATGCGTATCGCGGAGTTGGGGCATGAGTTAAGTAAACTTAATTCGTCT
AAGGTCACGATCAGCCTATTTACTAAACAATTGCCCCCTGAATTTCTAAGGTTGTTTAACAAGAAGGTCT
TTTGCCTGAATACGGTCCCAGCTATCAATATTTTTGAGTGTCGAGGGGAGCCTATTAAATATGACTTTTC
TAAGTTATCTGTGCCGGTTATCGCAGATTTGCATTCAGAGAATGAACAGACCGTTGTCTCAGTTAATACC
GTTAAAGAAGTGCTTCCTACTGGTGAGTTTGAGCTGAGCCCTGTCTATGAGGGAGGGTATTGGCATGATG
AATCTTCTCCACAATGGCAGAGTCGGCAGCATTGGGACGAAAAAGGGCGTAGGAAAGTGTCTCTCTCTAT
TAGTTACCCTTATAGCTCACAGAGTAAAAATAGCGTTGTTTTAGCGACGAATCTAAGTGTTTGCAATGGC
CGATTGCCCTGTTTGATTGCTGCAAATCAACCGGTAGAACTCATGGCTTCGATTGAGTTACCAGGTGACC
TGCGAGTGATGTCGACACCGACAGCGCCACAATACCCAAACCTTGATAACCAATTGAATTGGCGTTTCAT
GGCGCTTCTTAATGTCAATTTTTCAAGCCTAGTACAATCCGATGATACGGTGAAGATGCTGCAAGAATCG
TTACGCATGTGTAGTCCAAATCAAACTTGCTCTCAGGCTGATGCGATTAAACAGCTTGAATATAAGCACT
TAGTTGCCCCTATGAGTATCCGCCAGCAATCTGTGTTCGCGTCAGGTACGGAAGTGACGATTATGTTGGA
TGACGAAATGCTAGGAAATAATATTGCGATTTTAGGTGAAGTGTTAAATCAGTATTTTCAGCAATTTTGT
AGTTTTGACCGCTTTATGCAGGTGAAAATTAAACGCTTTGGTAATGATGCAGAAAGCATTGAATACGACA
AGGTTCATGGGAGCCAATTATGTCTGTAG