SecReT6
Protein ID: 333907050
SecReT6 ID440
T6SS typei5
Gene symbol-
Locus tagMar181_0661
StrainMarinomonas posidonica IVIA-Po-181
Repliconchromosome [GenBank: NC_015559] [Browse all T6SS(s) in this replicon]
Location [Strand]720943..723552 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDF6D0Z4
KEGG IDmpc:Mar181_0661
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.60E-40, Aligned region: 219..238
AAA_2 [PF07724], Evalue: 2.60E-40, Aligned region: 599..766
AAA [PF00004], Evalue: 2.90E-20, Aligned region: 218..350
AAA [PF00004], Evalue: 2.90E-20, Aligned region: 490..525
AAA [PF00004], Evalue: 2.90E-20, Aligned region: 605..726
AAA_5 [PF07728], Evalue: 5.70E-14, Aligned region: 218..240
AAA_5 [PF07728], Evalue: 5.70E-14, Aligned region: 314..348
AAA_5 [PF07728], Evalue: 5.70E-14, Aligned region: 604..725
ClpB_D2-small [PF10431], Evalue: 1.80E-12, Aligned region: 484..506
ClpB_D2-small [PF10431], Evalue: 1.80E-12, Aligned region: 772..843
AAA_22 [PF13401], Evalue: 1.60E-09, Aligned region: 218..303
AAA_22 [PF13401], Evalue: 1.60E-09, Aligned region: 328..382
AAA_22 [PF13401], Evalue: 1.60E-09, Aligned region: 603..640
AAA_16 [PF13191], Evalue: 1.70E-09, Aligned region: 196..239
AAA_16 [PF13191], Evalue: 1.70E-09, Aligned region: 262..296
AAA_16 [PF13191], Evalue: 1.70E-09, Aligned region: 482..500
AAA_16 [PF13191], Evalue: 1.70E-09, Aligned region: 574..624
AAA_16 [PF13191], Evalue: 1.70E-09, Aligned region: 670..698
Zeta_toxin [PF06414], Evalue: 1.80E-06, Aligned region: 217..238
Zeta_toxin [PF06414], Evalue: 1.80E-06, Aligned region: 298..354
Zeta_toxin [PF06414], Evalue: 1.80E-06, Aligned region: 597..644
AAA_25 [PF13481], Evalue: 4.20E-06, Aligned region: 218..242
AAA_25 [PF13481], Evalue: 4.20E-06, Aligned region: 274..313
AAA_25 [PF13481], Evalue: 4.20E-06, Aligned region: 598..633
AAA_17 [PF13207], Evalue: 9.00E-06, Aligned region: 218..268
AAA_17 [PF13207], Evalue: 9.00E-06, Aligned region: 604..639
IstB_IS21 [PF01695], Evalue: 1.10E-05, Aligned region: 212..237
IstB_IS21 [PF01695], Evalue: 1.10E-05, Aligned region: 604..628
RNA_helicase [PF00910], Evalue: 0.00031, Aligned region: 219..239
RNA_helicase [PF00910], Evalue: 0.00031, Aligned region: 605..626
RNA_helicase [PF00910], Evalue: 0.00031, Aligned region: 702..722
AAA_18 [PF13238], Evalue: 0.00032, Aligned region: 218..243
AAA_18 [PF13238], Evalue: 0.00032, Aligned region: 607..633
Sigma54_activat [PF00158], Evalue: 0.00047, Aligned region: 215..233
Sigma54_activat [PF00158], Evalue: 0.00047, Aligned region: 604..722
AAA_19 [PF13245], Evalue: 0.00051, Aligned region: 215..239
AAA_19 [PF13245], Evalue: 0.00051, Aligned region: 602..626
AAA_10 [PF12846], Evalue: 0.00052, Aligned region: 218..240
AAA_10 [PF12846], Evalue: 0.00052, Aligned region: 284..307
AAA_10 [PF12846], Evalue: 0.00052, Aligned region: 604..643
NACHT [PF05729], Evalue: 0.00061, Aligned region: 218..245
NACHT [PF05729], Evalue: 0.00061, Aligned region: 461..473
NACHT [PF05729], Evalue: 0.00061, Aligned region: 605..627
ResIII [PF04851], Evalue: 0.0012, Aligned region: 203..239
ResIII [PF04851], Evalue: 0.0012, Aligned region: 278..300
ResIII [PF04851], Evalue: 0.0012, Aligned region: 576..626
AAA_33 [PF13671], Evalue: 0.0016, Aligned region: 218..235
AAA_33 [PF13671], Evalue: 0.0016, Aligned region: 603..623
Mg_chelatase [PF01078], Evalue: 0.0034, Aligned region: 214..254
Mg_chelatase [PF01078], Evalue: 0.0034, Aligned region: 605..622
TIP49 [PF06068], Evalue: 0.0047, Aligned region: 205..257
TIP49 [PF06068], Evalue: 0.0047, Aligned region: 267..298
TIP49 [PF06068], Evalue: 0.0047, Aligned region: 603..625
SRP54 [PF00448], Evalue: 0.0052, Aligned region: 218..240
SRP54 [PF00448], Evalue: 0.0052, Aligned region: 603..635
RuvB_N [PF05496], Evalue: 0.0055, Aligned region: 216..235
RuvB_N [PF05496], Evalue: 0.0055, Aligned region: 276..298
RuvB_N [PF05496], Evalue: 0.0055, Aligned region: 571..624
RuvB_N [PF05496], Evalue: 0.0055, Aligned region: 673..697
Protein Sequence: 869 a.a.     [Download]
>gi|333907050|ref|YP_004480636.1| type VI secretion ATPase, ClpV1 family [Marinomonas posidonica IVIA-Po-181]
MSYVKLGNLVSKLEADIKDALEQAAGDAMSQTASSIEIEHWMMQIISHQNNSLVSFLKNQNININQLVGE
LTHRIERFPKGATGQPTISGALSELMEESWVQASVNFGHTSVHALHLLLTMLQTDSFGVKKLNLKCLESV
SLEALSSKISQIKQTTATSSTKTEDLDAAPTAGGALDKYTVNLTQQARDGKIDPISGRNAEVRLAIDILC
RKRQNNPILVGEPGVGKTAVVEGLALRIASGEVPPVIQGVEIHSLDLGLLQAGASIKGEFENRLKDVINE
VKSSETPIIVFIDEAHTLIGAGGAAGQNDAANLLKPALARGEFKSIAATTWAEYKKYFEKDPALTRRFQV
VKVEEPSAEDAMQMLRGVAVSLKKHHNVFIREDALDAAVNLSIRYLPSRQLPDKAISLLDTACARIALTQ
GAKPERVEFLEQKIRYLNSELEAYKVEDAVLSDLPEDSQVLVDDVAKMEAELSELNVKWQNELELVQQVV
ELSDEIQSQFQDDAIEADKQDKLQGLLSQLKVVQGESPLVYPMVNAEVIASVISSWTGIPAGSMVKGEVA
ALLSLEKALHKRVIGQETAISELAKSIRISRAGLTDNRKPVGVFLMCGPSGVGKTETAMALADQVFGGGD
NLTIINMTEFKEEHKISMLLGSPAGYVGFGEGGVLTEAIRRNPYSVLLLDEMEKAHPGVHDLFYQIFDKG
HIKDSEGRTVDFKNTIIIMTSNAADQAICDICAETNERPVNEVLVEEIRPALQTYFKPAFLGRTTIVPYY
PLNAEELGHIAQISLNRISKKLAEKYKASFSWGIEFVDFIVSRNTDPTTGGRAIEQMINRALMPKLAEEC
IQRLSDGLPISCVSVDVIPQTGEIKLTIE
 
Nucleotide Sequence: 2610 bp     [Download]
>ref|NC_015559.1|:720943-723552 type VI secretion ATPase, ClpV1 family [Marinomonas posidonica IVIA-Po-181]
ATGTCATACGTAAAATTAGGAAATCTAGTCAGTAAATTAGAAGCCGATATCAAAGATGCTTTAGAGCAAG
CGGCAGGTGATGCTATGTCGCAAACTGCTAGCTCGATTGAAATTGAGCATTGGATGATGCAAATTATTTC
TCATCAAAATAACAGCTTGGTGTCTTTTTTAAAAAATCAAAATATTAATATTAATCAACTGGTTGGAGAG
CTTACTCACCGTATAGAGCGTTTTCCTAAGGGAGCGACGGGCCAACCGACTATTAGCGGTGCTCTGAGTG
AGTTAATGGAAGAGTCTTGGGTACAAGCATCGGTTAATTTTGGGCATACTAGTGTGCATGCTTTGCACCT
TCTACTAACTATGCTTCAAACAGATTCTTTTGGGGTGAAAAAATTAAACCTTAAGTGTCTTGAATCTGTA
TCGCTTGAAGCACTGAGCAGTAAAATTTCTCAAATAAAGCAAACGACAGCGACATCATCAACAAAGACAG
AGGACCTTGATGCGGCGCCTACAGCTGGTGGGGCACTAGATAAATATACGGTGAACCTTACCCAGCAAGC
TCGCGATGGAAAGATAGATCCCATTTCTGGACGTAACGCTGAAGTGCGTTTAGCTATTGATATCTTGTGC
CGTAAACGTCAGAACAATCCTATTTTGGTTGGCGAACCTGGTGTTGGTAAAACCGCAGTAGTGGAAGGCT
TAGCATTGAGAATTGCTAGTGGTGAAGTGCCACCGGTTATTCAAGGTGTTGAAATACACTCTTTGGACTT
AGGTTTATTACAAGCGGGAGCCAGTATCAAAGGTGAGTTTGAAAATCGCTTAAAAGATGTCATTAATGAG
GTGAAGAGCTCAGAAACTCCTATTATTGTCTTTATTGATGAGGCACATACTTTGATTGGCGCTGGAGGTG
CTGCGGGTCAAAATGATGCCGCGAATCTATTAAAGCCAGCTTTAGCACGAGGCGAATTTAAGTCAATTGC
TGCCACAACTTGGGCTGAATATAAAAAATACTTTGAGAAAGACCCTGCATTAACCCGTCGCTTTCAAGTG
GTTAAAGTAGAAGAGCCTAGCGCAGAAGATGCCATGCAAATGCTGCGTGGTGTTGCCGTTTCTCTAAAGA
AACATCACAACGTTTTTATTCGCGAAGATGCATTAGATGCTGCGGTAAACCTTTCGATCCGTTACCTACC
TTCTAGACAACTCCCAGATAAAGCCATTAGCCTTTTGGATACGGCGTGTGCTCGTATTGCTTTAACTCAA
GGTGCGAAACCTGAACGGGTTGAGTTTCTAGAGCAAAAAATTCGCTACCTGAATAGTGAGTTAGAAGCTT
ACAAAGTTGAAGATGCTGTGTTAAGTGACCTTCCAGAAGATAGCCAAGTGTTGGTCGATGATGTCGCTAA
AATGGAAGCTGAGCTAAGTGAACTGAATGTAAAATGGCAAAATGAGCTTGAGTTAGTTCAACAGGTTGTT
GAACTAAGTGACGAAATACAATCACAATTTCAAGATGACGCCATTGAAGCCGATAAACAAGATAAATTAC
AAGGCTTACTTTCCCAATTGAAAGTGGTTCAAGGGGAAAGTCCATTGGTCTATCCAATGGTTAATGCTGA
GGTAATCGCTTCTGTTATTTCCAGTTGGACAGGGATTCCTGCAGGGAGCATGGTAAAGGGTGAAGTTGCA
GCTTTGCTGAGTTTGGAAAAAGCATTGCATAAGCGTGTTATTGGTCAGGAAACAGCGATCAGTGAATTGG
CTAAGAGTATCCGAATTTCTCGTGCTGGTTTGACTGATAACCGAAAACCCGTTGGTGTTTTCTTAATGTG
TGGACCAAGTGGTGTGGGTAAAACTGAAACAGCGATGGCATTGGCGGATCAGGTTTTTGGTGGTGGGGAT
AATTTAACCATCATTAACATGACGGAATTTAAAGAAGAACATAAAATTTCTATGCTGTTAGGTTCCCCTG
CGGGTTATGTTGGTTTTGGTGAAGGTGGTGTCTTAACTGAAGCTATTCGTCGTAATCCATACTCAGTTTT
ATTATTGGATGAAATGGAAAAAGCTCATCCAGGTGTTCATGATTTGTTTTATCAAATATTTGATAAAGGT
CATATTAAGGACAGTGAAGGTCGCACGGTCGATTTTAAAAACACCATTATTATCATGACCTCAAATGCAG
CGGATCAAGCGATTTGTGATATTTGTGCTGAGACGAATGAGCGCCCAGTAAATGAAGTGCTAGTTGAGGA
AATTCGTCCAGCATTACAAACTTACTTTAAACCTGCATTTTTGGGACGAACGACCATTGTGCCATATTAC
CCATTAAACGCGGAAGAATTAGGTCATATTGCTCAAATTAGCTTAAATCGAATTTCTAAAAAACTGGCAG
AAAAATACAAAGCAAGTTTTAGCTGGGGTATTGAGTTTGTTGACTTTATTGTGTCGCGTAATACGGATCC
AACAACAGGTGGTCGGGCGATTGAGCAAATGATTAACCGTGCTTTAATGCCCAAACTGGCAGAAGAGTGT
ATCCAGCGTTTAAGTGATGGGTTGCCCATATCATGTGTTAGTGTTGATGTCATTCCTCAAACTGGTGAAA
TTAAGCTTACAATCGAGTAA