SecReT6
Protein ID: 333907052
SecReT6 ID440
T6SS typei5
Gene symbol-
Locus tagMar181_0663
StrainMarinomonas posidonica IVIA-Po-181
Repliconchromosome [GenBank: NC_015559] [Browse all T6SS(s) in this replicon]
Location [Strand]724300..725283 [+]
ProductFHA domain-containing protein
NoteFha
UniProt IDF6D0Z6
KEGG IDmpc:Mar181_0663
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 2.90E-19, Aligned region: 29..96
Protein Sequence: 327 a.a.     [Download]
>gi|333907052|ref|YP_004480638.1| FHA domain-containing protein [Marinomonas posidonica IVIA-Po-181]
MSISLQLVELPENEQVTSRQISLPDSGGTIGRSFDCTIQLPDFNRSLSRVHAEIVLSQKGRYQLIDRSTN
GVYVNGRLIGKGAKHTLADGDNIKMGAYTLLVSDMESLFVQEDIPVLDESLDDPNSAVFDVKNLEMDSPI
KANNPIDQKSYNSLFNEEEADVPSFSKKNVMEEDSFGYDPFESMQEDLQMRDPNEVTEVDEDAEVIQFNA
NDLAVSTYNEARDEEKRALHNSVMQLNKIIEQQQNTLSGSIAHERLMSCLEATFEKFIAELSPVNLEDEF
NSYLSGWGAKDKKYWSLYKKQFIRKQERGEYYRQFYALLFEELREKR
 
Nucleotide Sequence: 984 bp     [Download]
>ref|NC_015559.1|:724300-725283 FHA domain-containing protein [Marinomonas posidonica IVIA-Po-181]
ATGAGTATCAGCTTACAGCTCGTCGAGTTGCCTGAAAATGAGCAAGTTACAAGTAGACAGATTTCTCTAC
CTGATTCTGGTGGAACAATTGGACGTTCGTTTGACTGTACTATTCAGCTACCAGATTTTAACCGTTCTTT
GTCTAGGGTTCATGCCGAAATCGTTTTATCTCAGAAAGGCCGTTATCAGCTGATTGACAGAAGTACGAAT
GGAGTCTACGTCAATGGCCGCTTAATTGGTAAAGGCGCTAAGCACACTCTTGCTGATGGCGATAATATTA
AGATGGGGGCTTACACTCTTTTGGTGAGCGATATGGAATCGCTATTTGTACAAGAGGATATTCCTGTTTT
AGATGAGAGTCTGGATGATCCTAACTCTGCTGTATTTGACGTGAAAAATTTAGAAATGGATTCTCCTATT
AAAGCCAATAATCCTATAGATCAAAAGAGCTACAACTCACTTTTTAATGAAGAGGAAGCTGATGTACCCT
CTTTTTCAAAAAAAAATGTGATGGAGGAAGATTCCTTTGGTTATGATCCATTTGAATCGATGCAAGAAGA
TCTACAGATGCGGGATCCTAATGAGGTCACGGAAGTAGATGAAGATGCCGAGGTGATACAATTTAATGCG
AACGACTTGGCGGTCAGTACATACAATGAAGCAAGGGACGAAGAGAAAAGAGCATTGCACAATAGTGTCA
TGCAGTTGAACAAAATTATTGAACAACAGCAAAATACGCTCTCGGGTTCAATTGCCCATGAACGGTTAAT
GTCCTGCTTGGAAGCTACTTTTGAGAAGTTCATTGCAGAATTAAGCCCTGTTAATCTTGAGGACGAGTTT
AATAGTTACCTTTCTGGTTGGGGGGCTAAGGATAAAAAATATTGGTCTTTATATAAAAAGCAGTTTATTC
GTAAGCAAGAACGTGGCGAGTATTACCGTCAGTTTTATGCCTTGCTTTTTGAAGAACTTAGAGAGAAACG
ATGA