SecReT6
Protein ID: 333907053
SecReT6 ID440
T6SS typei5
Gene symbol-
Locus tagMar181_0664
StrainMarinomonas posidonica IVIA-Po-181
Repliconchromosome [GenBank: NC_015559] [Browse all T6SS(s) in this replicon]
Location [Strand]725280..725783 [+]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDF6D0Z7
KEGG IDmpc:Mar181_0664
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.80E-30, Aligned region: 16..156
Protein Sequence: 167 a.a.     [Download]
>gi|333907053|ref|YP_004480639.1| type VI secretion lipoprotein [Marinomonas posidonica IVIA-Po-181]
MKLKCFKSVLCYIWIVILVGCSSSGSSPTFLPPFKVEVNIIPAEDINVYSDGSPHPVAIRVYQLREIGAF
TKSEFLELYNQDRSVLNEALVDMINISPVLPGKTQKLTLDIQQEARYLAVLAEFANYRQLVTKSYISLAD
DPDENPVYIRITSTEIDIKQPVDDSWW
 
Nucleotide Sequence: 504 bp     [Download]
>ref|NC_015559.1|:725280-725783 type VI secretion lipoprotein [Marinomonas posidonica IVIA-Po-181]
ATGAAATTGAAATGTTTTAAATCCGTACTTTGTTATATATGGATTGTGATATTGGTTGGCTGTAGTAGTT
CGGGGAGTTCACCTACTTTTTTACCTCCTTTTAAAGTGGAAGTTAATATTATACCAGCAGAAGATATTAA
TGTTTATTCAGACGGAAGCCCTCACCCAGTGGCAATTAGAGTGTATCAACTTAGAGAAATTGGGGCCTTC
ACTAAAAGTGAGTTCTTAGAACTTTATAATCAAGACCGAAGTGTTTTAAACGAAGCGCTAGTGGATATGA
TTAATATATCACCTGTATTACCAGGGAAAACACAGAAATTGACTTTGGATATTCAACAAGAGGCGCGTTA
TTTAGCGGTTTTGGCTGAATTTGCTAACTATAGACAGCTTGTCACCAAATCCTATATTAGCCTTGCGGAT
GATCCTGATGAAAACCCAGTTTATATAAGAATTACTAGTACAGAAATTGATATTAAACAACCAGTTGATG
ATTCCTGGTGGTAA