SecReT6
Protein ID: 333907054
SecReT6 ID440
T6SS typei5
Gene symbol-
Locus tagMar181_0665
StrainMarinomonas posidonica IVIA-Po-181
Repliconchromosome [GenBank: NC_015559] [Browse all T6SS(s) in this replicon]
Location [Strand]725767..727128 [+]
Producttype VI secretion lipoprotein
NoteTssK
UniProt IDF6D0Z8
KEGG IDmpc:Mar181_0665
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.80E-103, Aligned region: 31..452
Protein Sequence: 453 a.a.     [Download]
>gi|333907054|ref|YP_004480640.1| type VI secretion lipoprotein [Marinomonas posidonica IVIA-Po-181]
MIPGGNYFEEFKLRRHRKVVWNEGMFIAPQHFQQQERYLHHYVEQYTAQFTGGNRYGISTLEIDSHRLTI
GKLVISECCGVFPDGTYFESFRELVLDIPAATLEKRVFLALPMSVEGENEYGELKDLCRYSKVSINLFDS
SDSSQSSIETTLAEPNVRLVLEGDEITGMTLIPIARVLEKRESGEVILDKGFIPACLQYGASQILVERIK
ELFALTQARAQSIAQRIGAGQNRKSEQSLMKEYLWLQALNRWLPWLHLALNNSNMLLEELYEGLVRYSAE
LKSFEPNVADLPEPLIKDDLKAVFSKVFSALRSQLSMVQSDSVAEFKWDTNLFEKRRLLRTSVPNIHLME
NRRFVLAVESSIGASTLAQVFPSACTLSGITQIAELVRNGLSGIGLSVLPIAPNELKARADMCYFEIDTG
HAFWQEIKNKREAITLHVDSRVPDVALILYALG
 
Nucleotide Sequence: 1362 bp     [Download]
>ref|NC_015559.1|:725767-727128 type VI secretion lipoprotein [Marinomonas posidonica IVIA-Po-181]
ATGATTCCTGGTGGTAACTATTTTGAGGAGTTTAAATTGAGACGACATCGTAAAGTTGTATGGAATGAGG
GGATGTTTATAGCCCCTCAACATTTTCAGCAACAAGAGCGCTACTTGCATCACTATGTTGAACAATACAC
TGCTCAATTTACCGGTGGAAATCGCTATGGTATCTCTACGTTGGAGATTGATAGTCACCGATTAACTATA
GGGAAATTAGTGATATCTGAATGTTGTGGGGTTTTTCCTGATGGGACTTATTTTGAGAGTTTCCGTGAAT
TAGTGCTAGATATTCCTGCTGCGACATTAGAAAAACGTGTGTTTCTTGCTTTACCAATGTCCGTTGAAGG
TGAAAATGAATACGGAGAATTGAAGGATTTATGTCGATACTCAAAGGTTTCAATTAATTTATTTGACTCG
AGTGACTCGAGCCAAAGCTCTATCGAAACAACACTTGCGGAACCTAATGTTCGCTTAGTGTTAGAAGGTG
ACGAAATAACTGGAATGACGTTAATACCAATTGCTCGCGTGTTAGAGAAGCGTGAGAGTGGGGAAGTAAT
TCTAGATAAAGGGTTTATTCCTGCTTGTCTTCAGTACGGAGCGTCTCAGATTTTAGTTGAAAGAATCAAG
GAGTTATTTGCATTGACTCAAGCTCGTGCCCAGAGCATTGCGCAGAGAATAGGGGCAGGACAAAATAGGA
AAAGTGAGCAAAGTCTAATGAAAGAGTATTTATGGCTACAGGCCTTAAATCGCTGGCTTCCTTGGCTACA
TTTAGCACTTAATAATTCCAATATGTTATTGGAAGAGCTCTATGAAGGTCTAGTTCGCTATTCTGCTGAG
CTAAAAAGTTTTGAACCCAATGTTGCAGATTTACCTGAACCGTTAATAAAAGACGACTTGAAAGCTGTTT
TTTCGAAAGTGTTTTCAGCATTACGTTCACAGCTATCCATGGTGCAAAGTGATAGTGTTGCCGAATTTAA
ATGGGATACAAATTTATTTGAAAAACGTAGATTATTGAGAACATCTGTACCAAATATTCACTTGATGGAA
AATCGTCGATTTGTATTGGCAGTAGAATCTTCAATTGGAGCTTCGACATTAGCCCAAGTATTCCCTAGTG
CTTGTACATTATCTGGTATTACGCAAATTGCAGAACTGGTCCGAAATGGCCTTTCTGGTATAGGGCTTAG
TGTTCTTCCAATTGCGCCAAATGAGCTTAAAGCGCGTGCAGATATGTGTTATTTCGAAATAGATACAGGT
CATGCTTTTTGGCAAGAGATTAAAAATAAACGTGAAGCAATTACTCTGCATGTTGATAGCCGAGTTCCTG
ATGTAGCCTTAATACTATACGCTTTGGGGTAA