SecReT6
Protein ID: 333907055
SecReT6 ID440
T6SS typei5
Gene symbol-
Locus tagMar181_0666
StrainMarinomonas posidonica IVIA-Po-181
Repliconchromosome [GenBank: NC_015559] [Browse all T6SS(s) in this replicon]
Location [Strand]727133..728398 [+]
ProductDotU family type IV / VI secretion system protein
NoteTssL
UniProt IDF6D0Z9
KEGG IDmpc:Mar181_0666
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.80E-43, Aligned region: 54..260
SPOR [PF05036], Evalue: 5.00E-06, Aligned region: 36..52
SPOR [PF05036], Evalue: 5.00E-06, Aligned region: 84..96
SPOR [PF05036], Evalue: 5.00E-06, Aligned region: 346..413
Protein Sequence: 421 a.a.     [Download]
>gi|333907055|ref|YP_004480641.1| DotU family type IV / VI secretion system protein [Marinomonas posidonica IVIA-Po-181]
MNDFLDEETVAFKIESDEKSQINDDGYEILDNANPLKNASRYAIDLQKYQFFDNKILSASSELLSIAVSI
ARIQAPEDMYLFRAGLKRAVADLKNKVAALDYPPSVADKVCFLFCIMLDEQVLHSSWGEESGWENQTLVS
ELFGMKNGGEQFYLIAERALSQPILLVDLIELIYILLKMGFRGQYRVNSNNQLESLLKRLENAIFSQLHI
VEKKDGYGVGLSEDISKVKFTKPKPPVKYWRQFLLFILLIISVLVAISYWYEETLSQRGRSFYGLESFTE
EYYRPKGDGKEFTYLSTPEEMASNKKVTLTSKSNETVTTNDLSTSLKSEQKTVSSISGSNNADGTESWIV
QIATYSTLLAANNYVLKIDAVVKDAKIIKSNKLFKVVVETDNKNTANNILKKVKAFGVDDAFIIHSTKVR
Q
 
Nucleotide Sequence: 1266 bp     [Download]
>ref|NC_015559.1|:727133-728398 DotU family type IV / VI secretion system protein [Marinomonas posidonica IVIA-Po-181]
ATGAACGATTTCTTAGATGAAGAAACGGTTGCGTTTAAGATTGAATCTGATGAAAAGAGTCAAATTAATG
ACGACGGATATGAGATTTTAGACAATGCTAACCCGTTAAAGAATGCCTCTAGATATGCTATCGATTTGCA
AAAATATCAATTTTTCGATAACAAAATATTAAGTGCTAGCTCAGAACTTTTATCTATCGCAGTTTCAATT
GCTCGTATACAGGCTCCTGAAGATATGTATCTTTTTAGAGCTGGGCTTAAAAGGGCGGTAGCTGATCTAA
AAAACAAAGTTGCAGCATTAGATTATCCTCCTTCTGTAGCAGATAAAGTCTGCTTTCTATTTTGTATCAT
GCTTGATGAGCAGGTTTTACATAGTAGTTGGGGGGAAGAGTCTGGTTGGGAAAATCAAACTTTGGTCAGC
GAGTTATTTGGGATGAAAAATGGTGGTGAGCAATTTTATTTGATTGCTGAAAGAGCTTTATCACAACCTA
TTTTATTAGTCGATTTAATTGAACTGATTTATATACTTCTTAAAATGGGCTTTAGGGGGCAATATCGAGT
CAATAGTAACAATCAACTTGAAAGTCTATTAAAGCGTCTTGAAAATGCAATTTTTTCTCAATTGCATATT
GTTGAAAAGAAAGATGGGTATGGGGTTGGCCTTTCTGAAGACATTAGTAAAGTTAAGTTTACAAAACCTA
AGCCTCCCGTTAAATATTGGCGCCAGTTTTTATTGTTTATTTTGCTCATTATTTCTGTGCTGGTAGCAAT
ATCATATTGGTATGAAGAAACACTATCGCAAAGAGGTAGAAGCTTTTATGGATTGGAGAGTTTTACGGAA
GAATACTATAGGCCAAAAGGAGACGGTAAAGAATTTACTTATCTCAGTACACCAGAAGAAATGGCTTCTA
ATAAAAAAGTAACGCTTACTTCTAAATCCAATGAAACAGTGACAACAAATGACCTATCTACTAGCTTGAA
ATCAGAGCAAAAAACGGTCAGTTCGATTTCAGGGAGTAATAACGCTGATGGAACTGAATCTTGGATTGTT
CAAATTGCAACTTATTCAACGCTTTTGGCAGCGAATAACTATGTGTTAAAAATTGATGCTGTTGTCAAAG
ATGCAAAAATTATTAAGTCGAATAAGTTGTTTAAGGTCGTAGTTGAAACGGATAATAAAAATACAGCAAA
TAATATCCTGAAAAAAGTGAAAGCATTTGGTGTTGATGATGCTTTTATCATTCATAGTACTAAAGTTAGG
CAGTGA