SecReT6
Protein ID: 333908843
SecReT6 ID441
T6SS typei1
Gene symbol-
Locus tagMar181_2477
StrainMarinomonas posidonica IVIA-Po-181
Repliconchromosome [GenBank: NC_015559] [Browse all T6SS(s) in this replicon]
Location [Strand]2721990..2723954 [-]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDF6CWU8
KEGG IDmpc:Mar181_2477
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.20E-61, Aligned region: 43..338
Phage_GPD [PF05954], Evalue: 5.20E-61, Aligned region: 578..613
Phage_base_V [PF04717], Evalue: 9.60E-23, Aligned region: 377..476
Cupin_3 [PF05899], Evalue: 0.0069, Aligned region: 579..610
Protein Sequence: 654 a.a.     [Download]
>gi|333908843|ref|YP_004482429.1| ImpA family type VI secretion-associated protein [Marinomonas posidonica IVIA-Po-181]
MATLMFKLAVDGLDENTLLVREYRGQDSLSDSTLDDGTTCYGFRYQLSLASRRMDLSADTIVDKQAELTV
WRDGELVHRVHGIVRHFEKGDTGHNYTFYGLTLVPALERLSLRHNSRIFQKQSAKDILTQLITDMDMPAP
VFTLENEEPKEREFCVQYRETDADFLHRLAAEEGWVYYFSHEAGKHTLHFIDKSQALAVQNDAIAYNLLT
AGVSETPYINALSEHKQSLPSQSTLKDYSFKQPGYAALNQHTGTNLEHQLSLYEHFDAPGRFKDNATGQR
FARIRLEYLRRRAHLLTGDSDASAILVGRKIRIAGHFDASIQDNSWIPVQVEHHGTQPQVLEEEGGEGQT
SYQNHFTLIPGQVNWQATPQPQPSVDGPMMATVVGPAANDGDTPEEIYCDEHGRVKIQFAWDRYGQKDDF
SSCWVQVSQSWAGSQYGTIALPRIGTDVIVSFLNGDPDQPIITGRTYNADNLPPYALPANKTKTVWRSQT
HQGAGFNEISFEDQVGQEQVYLHAQKDLQTDVLHDQTTSIGNDQHLSVVNDSFSEVKNNQHITVKGERRS
KVTLDQTHIVEGSLQQQVGEIAVTEAGEDIQLQSGDLTVVEAGAELTVKVGGSFITINADGVYLVGPEVN
IGSETYEADELEDMITSSDFSFSG
 
Nucleotide Sequence: 1965 bp     [Download]
>ref|NC_015559.1|:c2723954-2721990 ImpA family type VI secretion-associated protein [Marinomonas posidonica IVIA-Po-181]
ATGGCGACGTTAATGTTTAAGCTGGCCGTTGACGGCCTCGATGAGAACACCTTGCTGGTACGAGAGTACC
GAGGCCAAGACTCTCTCTCGGATTCCACATTAGACGATGGGACCACTTGCTATGGGTTCCGTTATCAGCT
GAGCTTAGCCAGTCGTCGTATGGACTTGTCTGCGGACACCATCGTCGACAAGCAAGCAGAATTAACCGTC
TGGCGTGATGGTGAACTGGTTCACCGAGTGCATGGTATCGTCCGCCACTTTGAAAAAGGCGACACCGGCC
ACAACTACACCTTTTACGGCTTGACCCTAGTGCCCGCGTTAGAGCGACTGTCGTTACGCCATAACAGCCG
CATCTTCCAAAAACAAAGCGCCAAAGACATCCTCACCCAATTGATCACCGACATGGACATGCCGGCCCCT
GTGTTCACCTTGGAAAACGAAGAACCAAAAGAACGGGAGTTCTGCGTTCAATACCGTGAAACTGACGCCG
ACTTCCTACATCGATTGGCCGCCGAAGAAGGCTGGGTCTACTACTTTAGCCACGAAGCAGGCAAACACAC
CTTACACTTCATCGACAAGAGCCAAGCTTTAGCCGTACAAAACGACGCCATTGCCTACAACTTACTCACC
GCGGGCGTCTCCGAAACCCCTTACATCAACGCGCTCAGTGAACACAAACAATCCCTACCCAGTCAGTCGA
CCCTAAAAGACTACAGCTTCAAGCAACCCGGCTACGCGGCCTTGAATCAGCACACAGGGACCAACCTAGA
ACATCAACTGAGCCTCTACGAACACTTTGATGCCCCAGGCCGTTTTAAAGACAACGCCACTGGCCAACGT
TTTGCCCGCATCCGTTTAGAATACTTGCGCCGTCGAGCTCACCTACTGACCGGTGACAGCGACGCCTCAG
CGATCCTCGTTGGCCGCAAAATACGCATTGCCGGTCACTTCGACGCCAGCATCCAAGACAACAGCTGGAT
CCCTGTTCAAGTCGAACACCATGGCACCCAACCACAAGTCCTCGAAGAAGAAGGGGGCGAAGGCCAGACC
AGCTACCAAAACCACTTTACCCTGATCCCGGGCCAAGTGAACTGGCAGGCAACGCCACAACCGCAACCCA
GTGTTGATGGCCCCATGATGGCCACCGTGGTGGGGCCTGCGGCCAACGATGGTGACACCCCAGAAGAAAT
CTACTGTGACGAACACGGTCGAGTGAAAATCCAATTTGCTTGGGACCGTTACGGACAAAAAGACGACTTC
AGCTCCTGCTGGGTCCAAGTCTCCCAAAGCTGGGCGGGCAGCCAATACGGCACCATCGCGCTGCCACGTA
TTGGCACCGACGTCATCGTCAGCTTCCTCAACGGCGACCCAGACCAACCCATTATTACCGGTCGAACCTA
CAACGCTGACAACTTACCGCCTTACGCCTTACCGGCGAACAAAACCAAAACCGTGTGGCGCAGCCAAACC
CACCAAGGGGCCGGATTTAACGAAATCAGCTTCGAAGATCAAGTAGGTCAAGAACAAGTCTACCTGCACG
CCCAAAAAGACCTGCAAACCGACGTGTTACATGACCAGACCACAAGCATCGGTAACGACCAACACCTGAG
TGTGGTTAACGACAGCTTCAGTGAAGTGAAAAACAACCAGCACATCACGGTCAAAGGGGAACGTCGTAGC
AAGGTCACCTTAGACCAAACCCACATAGTCGAAGGCAGCTTGCAGCAGCAAGTCGGTGAGATCGCCGTGA
CCGAAGCAGGGGAAGATATACAGCTACAAAGTGGGGATCTTACCGTCGTGGAAGCTGGAGCTGAATTAAC
CGTGAAAGTCGGGGGAAGCTTCATTACCATTAATGCCGATGGCGTGTATTTAGTGGGGCCTGAGGTGAAT
ATTGGATCGGAAACTTATGAAGCGGATGAACTTGAAGATATGATCACAAGCAGTGATTTTAGTTTCTCAG
GTTAG