SecReT6
Protein ID: 333908844
SecReT6 ID441
T6SS typei1
Gene symbol-
Locus tagMar181_2478
StrainMarinomonas posidonica IVIA-Po-181
Repliconchromosome [GenBank: NC_015559] [Browse all T6SS(s) in this replicon]
Location [Strand]2724062..2726017 [-]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDF6CWU9
KEGG IDmpc:Mar181_2478
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.60E-61, Aligned region: 43..338
Phage_base_V [PF04717], Evalue: 1.10E-22, Aligned region: 377..476
DUF2345 [PF10106], Evalue: 5.70E-05, Aligned region: 508..537
DUF2345 [PF10106], Evalue: 5.70E-05, Aligned region: 583..626
Protein Sequence: 651 a.a.     [Download]
>gi|333908844|ref|YP_004482430.1| ImpA family type VI secretion-associated protein [Marinomonas posidonica IVIA-Po-181]
MATLMFKLAVDGLDENTLLVREYRGQDSLSDSTLDDGTTCYGFRYQLSLASRRMDLSADTIVDKQAELTV
WRDGELVHRVHGIVRHFEKGDTGHNYTFYGLTLVPALERLSLRHNSRIFQKQSAKDILTQLITDMDMPAP
VFTLENEEPKEREFCVQYRETDADFLHRLAAEEGWVYYFSHEAGKHTLHFIDKSQALAVQNDAIAYNLLT
AGVSETPYINALSEHKQSLPSQSTLKDYSFKQPGYAALNQHTGTNLEHQLSLYEHFDAPGRFKDNATGQR
FARIRLEYLRRRAHLLTGDSDASAILVGRKIRIAGHFDASIQDNSWIPVQVEHHGTQPQVLEEEGGEGQT
SYQNHFTLIPGQVNWQATPQPQPSVDGPMMATVVGPAANDGDTPEEIYCDEHGRVKIQFAWDRYGQKDDF
SSCWVQVSQSWAGSQYGTIALPRIGTDVIVSFLNGDPDQPIITGRTYNADNLPPYALPANKTKTVWRSQT
HQGAGFNEISFEDQVGQEQVYLHAQKDLQTDVLNDQTTSIGNDQHLSVVNDSFSEVKNNQHITVNGECQL
KVLKQDTSISEANFYRKVTQVNRLEAAQEIHLKSGAKAILEAKQAITIKAGGNYITIDQNGIQLMSANVT
FNEGGEAAVGSGFTDSTIASD
 
Nucleotide Sequence: 1956 bp     [Download]
>ref|NC_015559.1|:c2726017-2724062 ImpA family type VI secretion-associated protein [Marinomonas posidonica IVIA-Po-181]
ATGGCGACGTTAATGTTTAAGCTGGCCGTTGACGGCCTCGATGAGAACACCTTGCTGGTACGAGAGTACC
GAGGCCAAGACTCTCTCTCGGATTCCACATTAGACGATGGGACCACTTGCTATGGGTTCCGTTATCAGCT
GAGCTTAGCCAGTCGTCGTATGGACTTGTCTGCGGACACCATCGTCGACAAGCAAGCAGAATTAACCGTC
TGGCGTGATGGTGAACTGGTTCACCGAGTGCATGGTATCGTCCGCCACTTTGAAAAAGGCGACACCGGCC
ACAACTACACCTTTTACGGCTTGACCCTAGTGCCCGCGTTAGAGCGACTGTCGTTACGCCATAACAGCCG
CATCTTCCAAAAACAAAGCGCCAAAGACATCCTCACCCAATTGATCACCGACATGGACATGCCGGCCCCT
GTGTTCACCTTGGAAAACGAAGAACCAAAAGAACGGGAGTTCTGCGTTCAATACCGTGAAACTGACGCCG
ACTTCCTACATCGATTGGCCGCCGAAGAAGGCTGGGTCTACTACTTTAGCCACGAAGCAGGCAAACACAC
CTTACACTTCATCGACAAGAGCCAAGCTTTAGCCGTACAAAACGACGCCATTGCCTACAACTTACTCACC
GCGGGCGTCTCCGAAACCCCTTACATCAACGCGCTCAGTGAACACAAACAATCCCTACCCAGTCAGTCGA
CCCTAAAAGACTACAGCTTCAAGCAACCCGGCTACGCGGCCTTGAATCAGCACACAGGGACCAACCTAGA
ACATCAACTGAGCCTCTACGAACACTTTGATGCCCCAGGCCGTTTTAAAGACAACGCCACTGGCCAACGT
TTTGCCCGCATCCGTTTAGAATACTTGCGCCGTCGTGCTCACCTGTTGACCGGTGATAGCGACGCCTCAG
CGATCCTCGTTGGTCGCAAAATACGCATTGCCGGTCACTTCGACGCCAGCATCCAAGACAACAGCTGGAT
CCCTGTCCAAGTCGAACACCATGGTACCCAACCACAAGTCCTCGAAGAAGAAGGGGGCGAAGGCCAGACC
AGCTACCAAAACCACTTTACCCTGATACCGGGCCAAGTGAACTGGCAGGCAACCCCACAACCGCAACCCA
GTGTCGATGGTCCCATGATGGCCACCGTGGTGGGGCCTGCGGCCAACGATGGTGACACCCCAGAAGAAAT
CTACTGTGACGAACACGGTCGAGTGAAAATCCAATTTGCTTGGGACCGTTACGGCCAGAAAGACGACTTC
AGCTCCTGCTGGGTCCAAGTCTCCCAAAGCTGGGCGGGCAGCCAATACGGCACCATCGCGCTGCCACGTA
TTGGCACCGACGTCATCGTCAGCTTCCTCAACGGCGACCCAGACCAACCCATTATTACCGGTCGAACCTA
CAACGCTGACAACTTACCGCCTTACGCCTTACCGGCGAACAAAACCAAAACCGTGTGGCGCAGCCAAACC
CACCAAGGGGCCGGATTTAACGAAATCAGCTTCGAAGATCAAGTAGGTCAAGAACAAGTCTACCTGCACG
CCCAAAAAGACCTGCAAACCGACGTGTTAAATGACCAGACCACAAGCATCGGTAACGACCAACACCTGAG
TGTGGTTAACGACAGCTTCAGTGAAGTGAAAAACAACCAGCACATCACAGTGAATGGCGAATGTCAGTTA
AAAGTACTGAAACAGGATACTTCGATTTCAGAGGCAAACTTTTATCGCAAGGTAACTCAAGTTAATCGCC
TAGAAGCCGCACAAGAAATTCATTTAAAAAGTGGCGCAAAGGCCATTCTAGAAGCCAAGCAAGCCATTAC
TATTAAAGCTGGCGGGAATTACATCACCATAGATCAAAACGGCATTCAGTTAATGAGTGCTAACGTGACC
TTTAATGAAGGTGGTGAGGCGGCGGTAGGGTCTGGTTTTACCGACAGTACCATTGCGTCTGACTAA