SecReT6
Protein ID: 333908847
SecReT6 ID441
T6SS typei1
Gene symbol-
Locus tagMar181_2481
StrainMarinomonas posidonica IVIA-Po-181
Repliconchromosome [GenBank: NC_015559] [Browse all T6SS(s) in this replicon]
Location [Strand]2730518..2731927 [-]
Producttype VI secretion-associated protein
NoteTssA
UniProt IDF6CWV2
KEGG IDmpc:Mar181_2481
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 9.50E-09, Aligned region: 52..111
ImpA-rel_N [PF06812], Evalue: 9.50E-09, Aligned region: 353..368
Protein Sequence: 469 a.a.     [Download]
>gi|333908847|ref|YP_004482433.1| type VI secretion-associated protein [Marinomonas posidonica IVIA-Po-181]
MIFDAEEIRSKIKRPISDDILEGDDFSSDSLYEFIEEEMMKVGSLSHGSVKWDKVEENLIILLNEKTKDI
ILIDYFIECCKRRNNIVSFYLALSVISDFVSFYWSLCYPKKEGAAGKRYKIRVLDKIFKKIDLFIDSKMD
LDCELSFFDEIFKVNDELKDSLSLNEIFSEQADLLYKRIKSKFSDEKSRAELDAKSDVKEVSQEKKDDVI
KYNNSASSEKESRKKISEVIDIVKHGDEYASLALRLKRFNLWSSIKSLPDSNKNKTLIQALPKERIAEYF
SLLENPTYELWERVESTIVMAPFWIDGQYLSFLISDSLGLHEISETVFSETKRFIGKFPQIYDLTFKDGT
PFVSEDCADWLTAKSNDVSSSLISNSEELDSIKVEANEVFLERGLQEALKYLDVKISEASCQKDIYQLRL
ISSEMLKESGAEDIASQQFEFMFKQVSEMRVSEWDPIFLKRLKNSISFD
 
Nucleotide Sequence: 1410 bp     [Download]
>ref|NC_015559.1|:c2731927-2730518 type VI secretion-associated protein [Marinomonas posidonica IVIA-Po-181]
ATGATTTTTGATGCCGAAGAGATAAGGTCAAAAATAAAGCGGCCTATATCTGATGATATATTGGAAGGAG
ATGATTTTTCGTCTGACTCTCTCTATGAGTTCATAGAAGAAGAGATGATGAAAGTTGGTTCGCTTTCCCA
TGGCTCTGTTAAATGGGATAAAGTTGAAGAGAACCTGATCATACTTTTAAATGAAAAGACAAAAGATATT
ATCTTAATTGATTATTTTATAGAGTGCTGTAAAAGAAGGAATAATATCGTTTCATTTTATTTGGCTTTAT
CCGTAATTTCAGATTTTGTTTCTTTTTATTGGTCGCTTTGTTACCCCAAGAAAGAAGGGGCTGCTGGAAA
AAGGTATAAGATTCGAGTTCTGGATAAAATATTTAAAAAAATAGATTTGTTCATCGATTCAAAAATGGAT
CTTGATTGTGAATTGTCTTTTTTTGATGAAATTTTTAAAGTTAATGATGAACTAAAAGATTCACTGTCTC
TAAATGAAATTTTCTCCGAACAAGCTGACCTTCTGTATAAAAGAATTAAATCCAAGTTTAGTGATGAAAA
AAGCAGAGCTGAGTTAGACGCAAAAAGTGATGTTAAGGAAGTTTCACAAGAGAAAAAAGATGATGTCATT
AAATATAATAATTCAGCTTCCTCAGAAAAAGAAAGTCGTAAAAAAATTTCAGAAGTGATTGATATCGTTA
AACATGGCGATGAATATGCGTCACTAGCATTACGTTTGAAACGCTTTAACTTGTGGTCTTCTATTAAGTC
CTTGCCTGATTCTAATAAGAATAAAACACTTATTCAGGCTCTCCCAAAAGAGCGTATAGCAGAATACTTT
TCTTTGCTTGAAAATCCAACGTATGAATTATGGGAACGTGTTGAGTCCACTATTGTTATGGCGCCATTTT
GGATTGATGGGCAGTATCTAAGTTTCTTGATTTCAGATTCCCTAGGTCTGCATGAAATTTCTGAAACGGT
ATTTTCTGAAACAAAGAGATTCATCGGAAAATTCCCTCAGATATATGATCTGACTTTTAAAGATGGGACG
CCTTTTGTTTCTGAGGATTGTGCTGATTGGTTAACTGCTAAAAGTAATGACGTAAGTTCCTCTTTAATAT
CAAATTCTGAAGAGTTGGATTCTATAAAAGTGGAAGCTAATGAGGTGTTTTTAGAAAGGGGGCTTCAGGA
GGCGCTGAAATATCTTGATGTGAAAATTTCTGAAGCAAGTTGTCAAAAAGACATTTATCAACTTAGGCTC
ATTTCTTCGGAGATGCTTAAGGAAAGTGGTGCAGAAGATATTGCTTCGCAACAGTTCGAATTTATGTTTA
AGCAAGTTTCAGAAATGCGTGTTTCTGAATGGGATCCAATTTTTTTAAAGCGTCTAAAGAATAGTATTTC
TTTTGATTAG