SecReT6
Protein ID: 333908850
SecReT6 ID441
T6SS typei1
Gene symbol-
Locus tagMar181_2484
StrainMarinomonas posidonica IVIA-Po-181
Repliconchromosome [GenBank: NC_015559] [Browse all T6SS(s) in this replicon]
Location [Strand]2734110..2736704 [-]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDF6CWV5
KEGG IDmpc:Mar181_2484
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 4.20E-40, Aligned region: 221..296
AAA_2 [PF07724], Evalue: 4.20E-40, Aligned region: 447..482
AAA_2 [PF07724], Evalue: 4.20E-40, Aligned region: 602..763
AAA [PF00004], Evalue: 6.10E-19, Aligned region: 220..351
AAA [PF00004], Evalue: 6.10E-19, Aligned region: 608..726
AAA_5 [PF07728], Evalue: 1.60E-12, Aligned region: 220..240
AAA_5 [PF07728], Evalue: 1.60E-12, Aligned region: 279..350
AAA_5 [PF07728], Evalue: 1.60E-12, Aligned region: 607..725
AAA_16 [PF13191], Evalue: 2.30E-12, Aligned region: 87..115
AAA_16 [PF13191], Evalue: 2.30E-12, Aligned region: 197..237
AAA_16 [PF13191], Evalue: 2.30E-12, Aligned region: 264..298
AAA_16 [PF13191], Evalue: 2.30E-12, Aligned region: 582..646
AAA_16 [PF13191], Evalue: 2.30E-12, Aligned region: 673..701
AAA_16 [PF13191], Evalue: 2.30E-12, Aligned region: 765..784
ClpB_D2-small [PF10431], Evalue: 3.50E-10, Aligned region: 769..846
AAA_22 [PF13401], Evalue: 1.60E-09, Aligned region: 220..312
AAA_22 [PF13401], Evalue: 1.60E-09, Aligned region: 488..502
AAA_22 [PF13401], Evalue: 1.60E-09, Aligned region: 604..701
Arch_ATPase [PF01637], Evalue: 1.80E-05, Aligned region: 200..305
Arch_ATPase [PF01637], Evalue: 1.80E-05, Aligned region: 607..647
Arch_ATPase [PF01637], Evalue: 1.80E-05, Aligned region: 673..689
Arch_ATPase [PF01637], Evalue: 1.80E-05, Aligned region: 773..806
AAA_14 [PF13173], Evalue: 2.00E-05, Aligned region: 220..323
AAA_14 [PF13173], Evalue: 2.00E-05, Aligned region: 465..529
AAA_14 [PF13173], Evalue: 2.00E-05, Aligned region: 607..689
AAA_14 [PF13173], Evalue: 2.00E-05, Aligned region: 757..851
DUF258 [PF03193], Evalue: 8.50E-05, Aligned region: 186..237
DUF258 [PF03193], Evalue: 8.50E-05, Aligned region: 607..648
NACHT [PF05729], Evalue: 0.00028, Aligned region: 104..124
NACHT [PF05729], Evalue: 0.00028, Aligned region: 220..249
NACHT [PF05729], Evalue: 0.00028, Aligned region: 608..635
NACHT [PF05729], Evalue: 0.00028, Aligned region: 784..835
Sigma54_activat [PF00158], Evalue: 0.00042, Aligned region: 218..236
Sigma54_activat [PF00158], Evalue: 0.00042, Aligned region: 595..706
AAA_25 [PF13481], Evalue: 0.0005, Aligned region: 220..244
AAA_25 [PF13481], Evalue: 0.0005, Aligned region: 603..639
AAA_25 [PF13481], Evalue: 0.0005, Aligned region: 773..823
AAA_19 [PF13245], Evalue: 0.00056, Aligned region: 217..241
AAA_19 [PF13245], Evalue: 0.00056, Aligned region: 604..629
AAA_29 [PF13555], Evalue: 0.0006, Aligned region: 212..237
AAA_29 [PF13555], Evalue: 0.0006, Aligned region: 603..618
AAA_17 [PF13207], Evalue: 0.00074, Aligned region: 220..272
AAA_17 [PF13207], Evalue: 0.00074, Aligned region: 608..642
AAA_18 [PF13238], Evalue: 0.0011, Aligned region: 220..261
AAA_18 [PF13238], Evalue: 0.0011, Aligned region: 608..640
ResIII [PF04851], Evalue: 0.0034, Aligned region: 186..241
ResIII [PF04851], Evalue: 0.0034, Aligned region: 282..304
ResIII [PF04851], Evalue: 0.0034, Aligned region: 593..633
RNA_helicase [PF00910], Evalue: 0.007, Aligned region: 221..241
RNA_helicase [PF00910], Evalue: 0.007, Aligned region: 608..630
Zeta_toxin [PF06414], Evalue: 0.0085, Aligned region: 220..238
Zeta_toxin [PF06414], Evalue: 0.0085, Aligned region: 598..647
IstB_IS21 [PF01695], Evalue: 0.0095, Aligned region: 214..242
IstB_IS21 [PF01695], Evalue: 0.0095, Aligned region: 606..618
IstB_IS21 [PF01695], Evalue: 0.0095, Aligned region: 764..799
Protein Sequence: 864 a.a.     [Download]
>gi|333908850|ref|YP_004482436.1| type VI secretion ATPase, ClpV1 family [Marinomonas posidonica IVIA-Po-181]
MIRIELPVLISKLNSQCKIALENAASLCIDNKHSEVSLAHFISAMLENPLSDVRCILDIENISTESVTNA
IAKSYPVSADLDTYPPFSPLLVEALQEAWLLSSTELQQNELRSGAILLSTLLRKERYFSFELVSLLDQIN
TERLRKHFDDILKESSESVSQSEGNGNVSKIEPTQLYLEKYCTNITQQAQDGQLDPVLCRDEELNLIVDI
LCSRRKNNPIVVGEAGVGKSAVIEGLALRIISGQVPDKLKEVSLCSLDLGLLQAGASVKGEFEKRLKGVI
DEVKSSSKQIILFIDEAHTLIGSGNQEGGSDAANLLKPALARGELSTIAATTWKEYKKYFEKDPALTRRF
QLVKIEEPSIEQSVDILRGLHQVYEEAHGVFISDCALKAASELSARYLSGRQLPDKAIDVLDTACARLSI
NRSIPPKKLTVLESQKIARQREIDLLERQTLVGKSIDEEYLALLNEEEKVSEADTTALLTDWQTQKGIVD
EIVALRDKALSTTTETSELTKLKEDLTDSYQMFDSIPLDQHLVYPEVNKQQIAEVISDWTGIPISQMNSD
ELYKITHLPSILGEKIRGQDIAIKSIHRHLLTSRADLRRAGRPKGSFLLVGPSGVGKTETVIKLTEELYG
GKQFLTTINMSEYQEKHTVSRLIGSPPGYVGYGEGGILTEAIRKKPYSVVLLDEVEKAHPEVLNLFYQTF
DKGELSDGEGRSIDCQNVLFFLTSNLGYQTIVDSHNEPELLKDKLYPELAEYFKPALLARMEVVPYLPLD
NSALEEIVKSKISYIKELLTKRYSAEVIIDDTVYSEILKRANRSENGARLLEAIIEGELLPNISLPILSY
LAEEKDILSIYMTVTDGDFVGEVR
 
Nucleotide Sequence: 2595 bp     [Download]
>ref|NC_015559.1|:c2736704-2734110 type VI secretion ATPase, ClpV1 family [Marinomonas posidonica IVIA-Po-181]
GTGATTAGAATTGAATTACCTGTACTAATTTCAAAATTAAATTCTCAATGTAAAATAGCTTTGGAAAATG
CGGCTTCATTATGTATTGATAATAAACATAGTGAAGTAAGTTTGGCTCATTTTATTAGCGCTATGTTAGA
GAATCCACTTTCAGATGTGAGATGTATTTTAGACATTGAAAATATTTCTACAGAGAGTGTAACGAATGCC
ATTGCCAAAAGTTACCCTGTATCGGCTGACTTAGATACCTACCCACCTTTTTCTCCATTATTAGTCGAAG
CTCTCCAAGAAGCTTGGTTACTGTCTTCAACTGAGCTTCAGCAGAATGAGCTGAGATCGGGTGCCATTCT
ACTTTCTACTCTTCTTAGAAAGGAAAGGTACTTTTCGTTTGAGCTGGTGAGCCTTTTAGATCAGATCAAT
ACTGAAAGGTTGCGTAAGCACTTTGATGATATTCTGAAAGAAAGTTCTGAGAGTGTGAGCCAGTCTGAAG
GCAATGGAAATGTGTCTAAGATTGAACCGACACAACTCTATCTTGAAAAATACTGTACAAACATAACACA
GCAAGCACAGGATGGTCAGCTTGATCCGGTCTTGTGCCGGGATGAAGAATTAAACCTTATCGTTGATATT
CTATGTAGTCGAAGAAAGAATAATCCAATAGTGGTAGGTGAAGCTGGGGTTGGTAAAAGTGCCGTTATTG
AAGGTTTGGCACTTCGAATTATTTCAGGTCAGGTACCAGATAAATTAAAAGAAGTTAGCCTGTGTTCACT
CGACCTTGGATTGCTTCAAGCTGGCGCTTCCGTTAAAGGCGAGTTTGAAAAGCGCTTGAAGGGGGTTATT
GATGAAGTAAAATCTTCTTCTAAACAAATTATTCTTTTCATCGATGAAGCACACACTCTGATTGGTTCCG
GTAACCAAGAGGGGGGAAGTGATGCGGCCAATCTATTAAAGCCTGCGCTTGCTCGTGGTGAGCTGTCTAC
TATCGCAGCCACAACTTGGAAAGAATATAAAAAGTATTTTGAAAAAGACCCTGCCCTAACGAGACGTTTT
CAGTTAGTCAAAATTGAAGAGCCTTCCATTGAGCAATCCGTTGATATTCTTCGAGGCTTACATCAGGTGT
ATGAAGAAGCACATGGTGTATTTATTAGTGATTGCGCTTTAAAAGCCGCATCAGAATTATCGGCCCGTTA
TCTTTCAGGTAGGCAGCTTCCAGATAAAGCAATTGATGTGTTGGATACGGCGTGTGCACGATTAAGCATT
AATAGAAGCATACCACCTAAAAAACTGACGGTGTTAGAGAGTCAAAAAATTGCTCGACAACGAGAAATTG
ATTTATTAGAGCGTCAAACTCTGGTGGGCAAAAGTATTGATGAAGAGTACCTTGCGTTATTAAACGAAGA
AGAAAAAGTTTCGGAAGCGGACACCACGGCATTATTGACAGATTGGCAGACGCAGAAAGGAATTGTTGAT
GAGATAGTCGCTCTTCGTGATAAAGCCCTAAGCACTACGACGGAAACCAGTGAGTTAACCAAATTAAAAG
AAGATCTTACCGACAGTTACCAGATGTTCGACTCAATCCCGCTTGATCAGCATCTTGTCTACCCTGAAGT
AAACAAACAGCAGATTGCTGAAGTGATTTCTGATTGGACCGGGATTCCGATATCCCAGATGAACTCAGAT
GAACTCTATAAGATCACGCATTTACCCTCCATTCTTGGTGAGAAAATCAGAGGTCAGGATATTGCCATCA
AGAGTATTCACCGACATTTGTTAACGTCCCGTGCGGATCTAAGAAGAGCCGGTAGACCTAAAGGTTCCTT
CTTATTAGTTGGCCCTAGTGGTGTGGGTAAGACTGAAACTGTGATCAAACTAACGGAAGAGCTGTACGGT
GGGAAACAGTTTTTAACCACGATCAATATGTCTGAATATCAAGAGAAGCACACGGTATCTAGATTGATTG
GTTCACCTCCTGGCTATGTTGGGTATGGAGAAGGGGGGATTCTGACCGAGGCAATTAGAAAGAAACCCTA
TTCCGTTGTGTTACTGGATGAAGTAGAGAAAGCTCATCCAGAAGTGCTGAACCTGTTTTATCAAACCTTT
GATAAAGGTGAGTTATCTGATGGTGAGGGTAGAAGTATTGACTGTCAGAATGTCTTATTCTTCTTAACAT
CGAATCTAGGCTATCAAACAATAGTGGATTCTCACAATGAGCCTGAATTACTAAAAGATAAGCTTTACCC
AGAGCTTGCTGAATATTTCAAGCCAGCACTTTTAGCAAGAATGGAAGTTGTGCCTTATCTACCACTAGAT
AATTCTGCTCTTGAAGAAATAGTGAAATCGAAAATTTCGTATATAAAAGAATTGTTAACAAAGCGTTATT
CAGCTGAAGTTATTATTGATGACACTGTTTATTCTGAAATATTAAAAAGAGCTAATCGATCCGAGAATGG
GGCTAGGTTGCTTGAAGCCATTATCGAAGGAGAGCTGTTACCGAATATCTCTCTTCCAATACTGAGCTAT
TTAGCTGAAGAAAAAGACATCTTAAGCATTTATATGACAGTCACCGATGGGGATTTCGTTGGAGAGGTTC
GATAA