SecReT6
Protein ID: 333908851
SecReT6 ID441
T6SS typei1
Gene symbol-
Locus tagMar181_2485
StrainMarinomonas posidonica IVIA-Po-181
Repliconchromosome [GenBank: NC_015559] [Browse all T6SS(s) in this replicon]
Location [Strand]2736735..2737538 [-]
ProductDotU family type IV / VI secretion system protein
NoteTssL
UniProt IDF6CWV6
KEGG IDmpc:Mar181_2485
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.40E-64, Aligned region: 46..250
YukC [PF10140], Evalue: 0.0005, Aligned region: 189..257
Protein Sequence: 267 a.a.     [Download]
>gi|333908851|ref|YP_004482437.1| DotU family type IV / VI secretion system protein [Marinomonas posidonica IVIA-Po-181]
MSEEMMDYDENSDKKSGLYDDLLFDDAENINKDKDYWFQIRGHTDNPFIDSATNFFALSLRVKTLSDCPN
IDEIYKQTIEEINITEIELTEKGYDHTVLMAYRYILCVFLDEAVMGTNWGGDSIWAQYSMLSRFHNETWG
GEKVFEIMTRLEKDPTRYKELLEFLYQCLILGFQGKFKVMKNGKEEREKIINKLHSLLENINDKNVSLSS
PTQAVVNKRYKLRRQIPVWLIFMVFSIGWVAIYLFYYFLLNTKSQDVLDQLSQILRL
 
Nucleotide Sequence: 804 bp     [Download]
>ref|NC_015559.1|:c2737538-2736735 DotU family type IV / VI secretion system protein [Marinomonas posidonica IVIA-Po-181]
ATGAGTGAAGAAATGATGGACTATGATGAGAATTCTGATAAGAAATCTGGATTATACGATGATTTATTAT
TTGATGATGCCGAAAATATAAATAAGGATAAAGATTATTGGTTTCAAATAAGAGGGCATACCGATAATCC
TTTTATTGATTCAGCAACTAACTTTTTTGCTCTTTCACTTCGAGTTAAAACATTAAGTGATTGTCCTAAT
ATTGATGAAATCTATAAACAAACAATAGAAGAAATCAACATCACTGAAATTGAGCTTACTGAAAAAGGTT
ATGACCATACAGTGCTAATGGCATATAGATATATTCTATGTGTTTTTTTAGACGAAGCCGTAATGGGAAC
CAATTGGGGTGGTGATTCTATTTGGGCTCAGTACTCAATGCTTTCTCGGTTCCATAACGAAACCTGGGGT
GGTGAAAAGGTTTTTGAGATCATGACTCGGCTTGAAAAAGATCCGACTCGATATAAGGAATTATTAGAAT
TCCTTTATCAGTGTTTGATACTGGGTTTTCAAGGTAAGTTTAAGGTTATGAAAAATGGCAAAGAGGAAAG
GGAAAAAATAATAAACAAACTGCACAGTTTGCTAGAAAATATTAATGATAAAAATGTGTCATTAAGTTCG
CCAACGCAAGCTGTCGTAAACAAAAGATATAAGTTAAGACGTCAAATACCAGTGTGGTTAATCTTTATGG
TATTTTCGATTGGTTGGGTCGCAATATATTTATTTTACTATTTTTTATTGAACACCAAATCGCAAGATGT
ACTTGATCAACTAAGTCAAATTTTAAGATTGTAG