SecReT6
Protein ID: 333908852
SecReT6 ID441
T6SS typei1
Gene symbol-
Locus tagMar181_2486
StrainMarinomonas posidonica IVIA-Po-181
Repliconchromosome [GenBank: NC_015559] [Browse all T6SS(s) in this replicon]
Location [Strand]2737541..2738875 [-]
Producttype VI secretion lipoprotein
NoteTssK
UniProt IDF6CWV7
KEGG IDmpc:Mar181_2486
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.70E-159, Aligned region: 19..443
Protein Sequence: 444 a.a.     [Download]
>gi|333908852|ref|YP_004482438.1| type VI secretion lipoprotein [Marinomonas posidonica IVIA-Po-181]
MIPRNRVIWSEGLFIKPQHFQQQSRYEENILNERLLSVSSYLYGLSSLSINPEYLSFGRIAIDQATGVIP
DGTVFRIPQEDMQPDPLEIGDANLSGQVVYLALPLKNDSLMEVDWPHEKGTGRFASRQHEVKDTHSIDGD
VAKLDLASVRLKLMLEKDDRSSYASIAIARIREKRPDGSVVLDDEFIPCHFDVYCSALLHRCINEISGLM
KERAKGISRRLGSSGQGAVADVSDFMLLQVLNRLQPVLQHLVNLRSLHPERLYELLSSMCGELATFIDES
RLPPELSGYNHDMPSDSFWQVIRYLRQSLSVVVEPRALSLQLQKRKYGLMVAPIHDEKLIESAEFVLSVK
ADMPLDELRSLFSQQTKVSSVEKIRDLISHQLPGIPVIPLPVAPRQLPYHSGYTYYQLDKTSAAWKMLEN
SSGFAFHVAGAFEGLDLQFWAIRD
 
Nucleotide Sequence: 1335 bp     [Download]
>ref|NC_015559.1|:c2738875-2737541 type VI secretion lipoprotein [Marinomonas posidonica IVIA-Po-181]
ATGATTCCTCGTAATAGAGTTATTTGGAGTGAAGGTTTATTTATAAAACCGCAGCACTTTCAACAGCAAA
GTAGATATGAAGAAAATATTTTAAATGAACGATTGCTTTCGGTAAGTAGTTATTTATATGGTCTTTCATC
ACTATCGATTAATCCAGAGTATCTTTCCTTTGGTCGAATTGCTATTGATCAAGCGACTGGCGTTATTCCT
GATGGGACTGTCTTTAGGATTCCACAAGAGGACATGCAACCTGATCCATTAGAGATAGGTGACGCAAATT
TATCGGGTCAAGTTGTATACCTTGCTTTGCCATTAAAAAACGATTCACTAATGGAAGTGGATTGGCCTCA
TGAAAAAGGAACGGGGCGATTTGCAAGCCGTCAACATGAGGTAAAGGATACGCATTCAATCGACGGTGAT
GTTGCAAAGCTTGACCTTGCCTCTGTACGACTAAAGCTTATGTTAGAAAAAGATGATCGAAGCAGCTATG
CCTCAATTGCTATTGCAAGAATACGTGAAAAGCGACCGGATGGCAGTGTTGTGTTAGATGATGAGTTTAT
TCCGTGTCACTTTGATGTTTATTGTAGTGCCTTGCTGCATAGATGCATTAATGAAATTTCAGGGTTAATG
AAAGAGAGAGCAAAGGGCATATCAAGACGTTTAGGCTCGTCAGGACAAGGCGCGGTAGCGGATGTCTCTG
ATTTCATGCTGCTACAAGTGTTAAACAGACTGCAACCTGTATTACAGCATCTTGTGAATTTGCGAAGTCT
GCACCCAGAACGATTATATGAATTGTTATCGTCTATGTGTGGTGAGTTAGCCACTTTTATTGATGAAAGC
CGATTGCCACCAGAGCTTTCTGGTTATAACCATGATATGCCCAGCGACTCTTTTTGGCAGGTTATACGAT
ATCTACGTCAGAGTTTAAGTGTTGTGGTTGAGCCACGAGCACTCTCTCTACAATTACAGAAGAGAAAATA
TGGCTTAATGGTTGCGCCTATTCATGATGAAAAACTGATTGAAAGCGCAGAGTTTGTTCTATCGGTGAAA
GCCGACATGCCTCTCGACGAGCTGAGAAGCTTGTTTAGTCAACAGACGAAAGTGTCTTCTGTTGAGAAAA
TACGTGATCTTATTTCTCACCAATTACCGGGCATTCCGGTGATACCTCTGCCTGTTGCCCCAAGACAATT
ACCTTACCACTCTGGTTATACCTATTACCAATTAGATAAAACCAGTGCCGCTTGGAAAATGCTGGAGAAT
TCATCCGGTTTTGCATTCCATGTCGCTGGGGCGTTTGAAGGTCTAGATCTACAATTTTGGGCAATAAGGG
ATTAG