SecReT6
Protein ID: 333908853
SecReT6 ID441
T6SS typei1
Gene symbol-
Locus tagMar181_2487
StrainMarinomonas posidonica IVIA-Po-181
Repliconchromosome [GenBank: NC_015559] [Browse all T6SS(s) in this replicon]
Location [Strand]2738880..2739383 [-]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDF6CWV8
KEGG IDmpc:Mar181_2487
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.70E-33, Aligned region: 17..156
Protein Sequence: 167 a.a.     [Download]
>gi|333908853|ref|YP_004482439.1| type VI secretion lipoprotein [Marinomonas posidonica IVIA-Po-181]
MLNNKVVSFLLVLVAVVSLSGCGSAQQIFKPTTPADQLTKLTFSLVADDEVNPNFLGGASPIEVQVFELV
DDSMFMSADFEEINNDYEEVLKTNFVKSYDYFILPGQFKFIDSFEIQSDTNYIGVVAKFSEPNLSEWKKA
VKIINRGRVYHLLMFFNDYEVKLDRVE
 
Nucleotide Sequence: 504 bp     [Download]
>ref|NC_015559.1|:c2739383-2738880 type VI secretion lipoprotein [Marinomonas posidonica IVIA-Po-181]
ATGCTGAACAATAAGGTCGTCTCATTCCTGCTAGTTTTGGTGGCTGTGGTTTCATTATCTGGTTGTGGTT
CTGCCCAGCAGATATTTAAGCCAACAACACCAGCGGATCAATTAACTAAACTAACGTTTAGTTTGGTTGC
TGATGATGAAGTGAATCCGAATTTTTTAGGGGGAGCGTCTCCTATTGAGGTTCAAGTATTTGAGCTGGTT
GATGATTCTATGTTCATGTCTGCGGATTTTGAGGAAATTAATAATGACTATGAGGAAGTTTTAAAAACAA
ACTTTGTCAAAAGTTATGATTATTTCATTCTGCCGGGACAATTTAAGTTTATAGACAGTTTTGAAATACA
GAGTGATACAAATTATATAGGTGTGGTGGCTAAATTTTCTGAACCTAATCTCAGTGAATGGAAAAAAGCC
GTAAAGATTATTAATCGGGGGAGAGTGTATCATTTATTGATGTTCTTCAATGATTATGAGGTTAAGTTAG
ATAGGGTTGAATGA