SecReT6
Protein ID: 333908855
SecReT6 ID441
T6SS typei1
Gene symbol-
Locus tagMar181_2489
StrainMarinomonas posidonica IVIA-Po-181
Repliconchromosome [GenBank: NC_015559] [Browse all T6SS(s) in this replicon]
Location [Strand]2740866..2741840 [-]
Producttype VI secretion lipoprotein
NoteTssG
UniProt IDF6CWW0
KEGG IDmpc:Mar181_2489
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.60E-89, Aligned region: 15..310
Protein Sequence: 324 a.a.     [Download]
>gi|333908855|ref|YP_004482441.1| type VI secretion lipoprotein [Marinomonas posidonica IVIA-Po-181]
MNNTSLPNNEMLVRDIKKYNFYQLVEVLHKEFDIDPELKSLDTDCRLTFSANPSLGFSASDVAKMTLIGD
GKAEVQTNFFGITGAQSPLPSYILEQLVSDDAEVKRKFLDFFNNRLISLVYQSWRKYRYYVRFQEEAKDK
FSNQLFSLVGLADDDLRGDTPINWCKMLAYSGTLAGKSRSPQVVSGIISHCFDLEEVSIKQWVKRKVLIK
ENQQVRLGMKNSTIGQDVVVGNYVNDIKGKFILQLKGLSRDQFLDFLPSGKEFLPLCKLVEFILREQMAY
DLELVLNESQTPKTSLGNGDFSLGWSSFLGDSKSERKVLIQVRN
 
Nucleotide Sequence: 975 bp     [Download]
>ref|NC_015559.1|:c2741840-2740866 type VI secretion lipoprotein [Marinomonas posidonica IVIA-Po-181]
ATGAATAATACCTCTTTGCCTAATAATGAAATGCTTGTTAGAGATATTAAGAAATACAATTTTTATCAGC
TAGTAGAAGTACTTCATAAAGAATTTGACATTGATCCAGAATTGAAGAGTTTGGACACTGACTGTCGACT
CACGTTTAGTGCGAACCCTAGTCTAGGATTTTCAGCCAGTGATGTCGCAAAAATGACATTGATTGGTGAT
GGAAAGGCTGAAGTTCAAACCAATTTTTTTGGTATTACGGGAGCTCAATCTCCATTACCAAGTTATATAT
TGGAGCAGCTGGTTAGCGACGATGCTGAAGTCAAAAGAAAGTTTTTAGATTTTTTTAATAATAGATTGAT
TTCTTTGGTGTATCAGTCATGGCGTAAGTATCGGTATTACGTCAGGTTTCAAGAAGAGGCAAAAGACAAG
TTTTCGAATCAACTCTTCTCACTTGTGGGTCTTGCTGATGATGACTTGAGAGGGGATACGCCAATTAATT
GGTGTAAAATGCTGGCCTATTCAGGAACCCTAGCCGGTAAAAGTCGATCGCCACAAGTTGTCTCTGGAAT
AATATCTCATTGTTTTGATTTAGAAGAGGTTTCTATTAAACAATGGGTAAAAAGAAAAGTTTTAATTAAA
GAAAACCAACAAGTACGGTTGGGCATGAAAAACTCAACCATTGGTCAGGATGTGGTCGTTGGAAACTATG
TCAATGACATTAAAGGCAAGTTCATATTGCAATTGAAAGGTCTTAGTCGAGATCAGTTTTTAGATTTCTT
ACCTTCCGGGAAAGAGTTTTTGCCTCTTTGTAAGTTGGTGGAATTTATTCTTAGAGAGCAGATGGCATAT
GATCTTGAGCTCGTTTTAAATGAAAGCCAAACACCTAAAACATCTCTTGGAAATGGTGATTTTTCTTTAG
GTTGGTCATCATTTTTAGGCGATTCAAAAAGTGAAAGAAAAGTGCTGATTCAGGTAAGGAATTAA