SecReT6
Protein ID: 333908856
SecReT6 ID441
T6SS typei1
Gene symbol-
Locus tagMar181_2490
StrainMarinomonas posidonica IVIA-Po-181
Repliconchromosome [GenBank: NC_015559] [Browse all T6SS(s) in this replicon]
Location [Strand]2741840..2743609 [-]
Producttype VI secretion lipoprotein
NoteTssF
UniProt IDF6CWW1
KEGG IDmpc:Mar181_2490
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.30E-194, Aligned region: 4..589
Protein Sequence: 589 a.a.     [Download]
>gi|333908856|ref|YP_004482442.1| type VI secretion lipoprotein [Marinomonas posidonica IVIA-Po-181]
MSHEKYFREELEFLREQGKEFSEIHPQLSRYLHGRNVDPDVERLLEGFAFLTGRLREKIEDEFPELTHSM
INMLWPNYLRPVPSLSVIKFKPKEGVSVKHKINAGVSLNSKQIRGTTCQFRTCRDVDLYPIECEKITAQH
TREASVVELFFEIDGDLTAKEIDLDALRFYIGGDQYSAEMMYLWINHYLDKITVNYDDTNYSLKKEALSL
VGFDKKEALLPYPKNVYDGYRIIQEYLTFSEAFNFFDIEGIGEAIPRSASGRFSIKLHFNKTIDTGVKVS
EELFQLYCTPIINLFDHDADPIDLTGLKTEYKIIPSSVSPNHYEIFSINEVAGWQHSKNSESRVKSGKRV
YSEFESFQHEVERVRNREALYYRARVKESIKKDGFDRHISFIRGDESNAYNFDEAVSIKLTCTNRQLPVE
LGLKDICITTDSSPTFATFENIVIPTAPLRPVLDGSLLWTLISNLSLNYLSLLSKDALSSILRAYDFKAL
VNRQAEKISKQRLNGILSVETEPTDRIIYGMAVRGLRSTIELDLDYFSSEGSLYQFGTILSRFFSLYASI
NSFHELVVINSKNREVYTWGIQDGIQPLI
 
Nucleotide Sequence: 1770 bp     [Download]
>ref|NC_015559.1|:c2743609-2741840 type VI secretion lipoprotein [Marinomonas posidonica IVIA-Po-181]
GTGTCACATGAAAAGTATTTTAGAGAGGAATTAGAGTTTCTGAGAGAACAAGGAAAAGAGTTTTCTGAAA
TTCATCCTCAGTTGTCACGATATCTACATGGTCGCAATGTTGACCCTGATGTTGAACGCTTGTTGGAGGG
TTTTGCCTTTCTGACAGGACGATTAAGGGAGAAAATAGAGGATGAGTTCCCTGAGTTAACCCACTCTATG
ATTAACATGCTTTGGCCAAATTACCTTAGACCTGTTCCAAGTTTGAGTGTTATTAAATTCAAACCAAAAG
AGGGGGTCAGTGTTAAGCACAAAATCAATGCAGGGGTCAGTTTAAATAGCAAGCAAATCCGTGGGACAAC
GTGTCAGTTTCGAACTTGTAGAGACGTTGATTTGTACCCGATTGAATGTGAAAAAATCACAGCTCAGCAC
ACCAGAGAGGCGAGTGTTGTAGAGCTTTTTTTCGAAATTGATGGTGATTTGACCGCGAAGGAAATTGATT
TAGATGCATTAAGGTTTTATATCGGTGGTGATCAGTACAGTGCTGAAATGATGTACTTATGGATTAACCA
CTATTTAGACAAGATTACCGTTAATTATGATGATACTAATTACTCTTTGAAAAAAGAGGCGCTTTCTCTT
GTCGGTTTTGATAAAAAAGAAGCGCTCTTACCCTATCCTAAGAATGTTTATGATGGATATCGTATCATTC
AAGAATACTTAACATTTTCAGAAGCTTTTAACTTTTTTGACATAGAGGGAATTGGTGAGGCCATACCAAG
AAGTGCTTCTGGTCGATTCTCTATCAAGTTACATTTTAATAAAACCATCGATACTGGTGTTAAAGTTTCA
GAAGAACTGTTTCAGCTATACTGCACACCTATTATTAATTTGTTTGATCACGATGCAGATCCAATTGATC
TGACTGGATTAAAGACCGAATACAAAATCATTCCCTCTAGCGTGTCTCCTAATCATTATGAAATATTTAG
TATAAATGAAGTCGCAGGTTGGCAGCATAGTAAAAATAGTGAGTCAAGAGTAAAAAGCGGAAAAAGGGTT
TACTCTGAATTTGAAAGTTTTCAGCATGAAGTTGAAAGAGTGAGAAATCGCGAAGCGCTTTATTATCGTG
CCAGAGTAAAGGAAAGTATAAAGAAAGATGGCTTTGATCGACACATTTCATTTATAAGAGGGGACGAATC
TAATGCATATAATTTTGATGAGGCTGTATCCATTAAATTAACGTGTACAAATCGTCAATTGCCAGTAGAA
CTTGGCCTTAAAGATATTTGTATTACAACAGATTCTTCTCCTACCTTTGCAACGTTTGAAAACATTGTAA
TACCTACCGCGCCATTAAGACCAGTGCTTGACGGTAGTTTGTTATGGACCTTGATATCGAATCTTTCACT
TAATTATTTGTCTTTGCTTTCAAAAGATGCACTTAGCTCAATTCTTCGAGCGTATGATTTTAAGGCGCTT
GTAAATCGTCAGGCTGAAAAGATATCCAAACAAAGATTAAATGGTATTTTGAGCGTTGAGACGGAACCAA
CAGACCGTATTATCTATGGTATGGCGGTAAGAGGTTTACGATCTACCATTGAGCTCGATTTAGACTATTT
TTCTTCCGAGGGTAGTCTGTATCAATTTGGAACAATACTAAGTCGATTTTTTTCTCTTTATGCCAGTATT
AACTCATTTCATGAACTTGTCGTTATTAATTCAAAGAATAGAGAAGTTTATACGTGGGGAATTCAGGATG
GGATACAACCACTAATATAA