SecReT6
Protein ID: 333908857
SecReT6 ID441
T6SS typei1
Gene symbol-
Locus tagMar181_2491
StrainMarinomonas posidonica IVIA-Po-181
Repliconchromosome [GenBank: NC_015559] [Browse all T6SS(s) in this replicon]
Location [Strand]2743612..2744037 [-]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDF6CWW2
KEGG IDmpc:Mar181_2491
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.40E-16, Aligned region: 32..122
Protein Sequence: 141 a.a.     [Download]
>gi|333908857|ref|YP_004482443.1| type VI secretion system lysozyme-like protein [Marinomonas posidonica IVIA-Po-181]
MDEENAFGIGFLDRLGSEAEPISLTEGPNTMDVLNSIKSNVSNILNARSGEALSSPDLGLIDFNDALLET
MDLSLRVKLAIKGCLDKYEPRLCNIQIQNVTNSSSPLELCFQIQADVNSNALHEKVKISLLLGGDRKYRV
Y
 
Nucleotide Sequence: 426 bp     [Download]
>ref|NC_015559.1|:c2744037-2743612 type VI secretion system lysozyme-like protein [Marinomonas posidonica IVIA-Po-181]
ATGGATGAAGAAAATGCATTTGGCATTGGCTTTTTAGATAGGTTAGGGAGTGAGGCAGAGCCGATCTCCT
TGACCGAAGGGCCAAATACAATGGATGTGCTGAATTCAATCAAATCAAATGTTTCTAATATTTTGAATGC
AAGATCAGGTGAAGCTTTGTCTTCACCTGATCTTGGCTTGATTGATTTTAATGATGCTTTATTGGAAACC
ATGGACCTTTCATTAAGGGTGAAACTGGCGATTAAAGGGTGTCTGGATAAATATGAGCCTAGGTTGTGCA
ATATTCAAATTCAGAATGTTACCAACTCAAGCAGCCCTCTAGAGTTATGTTTTCAAATTCAAGCCGATGT
AAATAGCAATGCGCTTCATGAAAAAGTGAAAATCAGTTTGCTACTTGGTGGTGATCGTAAGTATAGGGTG
TATTGA