SecReT6
Protein ID: 333908858
SecReT6 ID441
T6SS typei1
Gene symbol-
Locus tagMar181_2492
StrainMarinomonas posidonica IVIA-Po-181
Repliconchromosome [GenBank: NC_015559] [Browse all T6SS(s) in this replicon]
Location [Strand]2744060..2745538 [-]
Producttype VI secretion lipoprotein
NoteTssC
UniProt IDF6CWW3
KEGG IDmpc:Mar181_2492
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 7.10E-191, Aligned region: 66..491
Protein Sequence: 492 a.a.     [Download]
>gi|333908858|ref|YP_004482444.1| type VI secretion lipoprotein [Marinomonas posidonica IVIA-Po-181]
MSTNNTAMEGIASEQINGNLLDEIMAQTKIAPNEEGYDVAKKGVAAFISNLLSSNQTDEPVNKNLVDQML
IELDRKISAQMDEILHDESIQQMESAWRGLKLLVDRTDFRENNKIELIHVTKDELLEDFEFAPETTQSGL
YKHVYSSGYGQFGGEPTGAIIGNYAFTPSSPDMKLLQYMASLGAMSHAPFISSVGPEFFGVDSFEEMSNL
KDLSSIFAGPKYTKWRSLRESEDARYLGLTAPRFLLRVPYDPIENPIKSFNYEENVSQSHSHYLWGNTAY
AFASKLTDSFSKYRWCPNIIGPQSGGAVEDLPVHVFESMGELQTKIPTEVLVTDRKEFELAEEGFIALTM
RKGSDNAAFFSANSVQKPKIFPNTKEGKEAETNYRLSTQLPYMMIINRLAHYVKVLQREQIGAWKERQDL
ERELNSWIKQYVADQENPPADVRSRRPLRGAKIEVSDVEGNPGWYQVSLSVRPHFKYMGANFELSLVGRL
DQ
 
Nucleotide Sequence: 1479 bp     [Download]
>ref|NC_015559.1|:c2745538-2744060 type VI secretion lipoprotein [Marinomonas posidonica IVIA-Po-181]
ATGTCTACAAATAATACAGCTATGGAAGGTATTGCCAGTGAACAAATCAATGGCAATTTATTAGATGAGA
TTATGGCGCAAACTAAGATTGCGCCGAATGAAGAAGGCTACGATGTTGCTAAAAAAGGCGTGGCCGCTTT
TATTAGTAATCTTTTGAGTTCTAATCAGACTGATGAGCCTGTTAATAAAAATCTTGTCGATCAAATGTTG
ATCGAATTGGATCGAAAAATCAGTGCTCAGATGGATGAGATTTTACATGATGAATCCATCCAGCAAATGG
AATCTGCATGGCGAGGCCTTAAGTTACTGGTTGATCGCACGGATTTCAGAGAGAACAACAAAATTGAGTT
GATTCATGTGACAAAAGACGAGTTGCTTGAAGACTTTGAATTTGCACCTGAAACAACGCAAAGTGGTCTG
TATAAGCATGTATATTCTTCAGGTTATGGCCAATTCGGTGGTGAGCCAACAGGCGCTATCATTGGTAACT
ATGCCTTTACGCCTTCTTCCCCTGATATGAAACTGTTGCAATATATGGCGTCGTTGGGTGCTATGTCACA
TGCTCCGTTTATCTCAAGTGTTGGTCCAGAGTTCTTCGGCGTGGATTCATTCGAAGAAATGTCAAACCTA
AAAGACTTGAGCTCTATCTTTGCCGGTCCAAAATACACCAAATGGCGCTCATTGCGAGAGTCAGAAGATG
CTCGCTATCTTGGTTTGACTGCGCCACGCTTCTTGCTGCGTGTTCCATATGACCCTATTGAAAACCCGAT
TAAATCTTTCAACTATGAAGAGAATGTTAGTCAGTCTCATAGTCATTATTTGTGGGGTAATACGGCGTAT
GCATTTGCATCAAAATTAACCGACAGCTTTTCAAAATACCGTTGGTGTCCAAACATTATTGGCCCGCAAA
GTGGTGGTGCGGTTGAAGATTTACCTGTGCATGTTTTCGAGTCTATGGGTGAATTGCAAACCAAGATACC
AACAGAGGTACTGGTCACTGACAGAAAAGAGTTTGAATTAGCGGAAGAAGGTTTCATTGCTCTTACTATG
AGAAAAGGCAGTGATAATGCCGCTTTTTTCTCTGCTAACTCTGTTCAAAAGCCTAAGATTTTTCCTAATA
CCAAAGAAGGGAAAGAAGCTGAAACGAACTACCGCTTAAGTACTCAGTTACCTTACATGATGATTATCAA
TCGCTTGGCACACTACGTTAAAGTGTTGCAGAGAGAGCAAATTGGCGCTTGGAAAGAGCGTCAAGATCTT
GAGCGTGAGCTAAATTCATGGATTAAGCAGTATGTTGCTGACCAGGAAAACCCGCCAGCGGATGTTCGCA
GTCGTCGCCCACTTCGTGGCGCTAAGATTGAAGTGTCTGATGTTGAAGGGAACCCAGGTTGGTATCAGGT
CTCTTTATCGGTTCGACCACACTTTAAATACATGGGTGCTAATTTCGAATTGTCTCTTGTCGGTCGTTTG
GATCAGTAA