SecReT6
Protein ID: 333908859
SecReT6 ID441
T6SS typei1
Gene symbol-
Locus tagMar181_2493
StrainMarinomonas posidonica IVIA-Po-181
Repliconchromosome [GenBank: NC_015559] [Browse all T6SS(s) in this replicon]
Location [Strand]2745570..2746085 [-]
Producttype VI secretion lipoprotein
NoteTssB
UniProt IDF6CWW4
KEGG IDmpc:Mar181_2493
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.20E-57, Aligned region: 5..157
Protein Sequence: 171 a.a.     [Download]
>gi|333908859|ref|YP_004482445.1| type VI secretion lipoprotein [Marinomonas posidonica IVIA-Po-181]
MSKEGSVAPKERINIKYIPATGDAQAEVELPLKTLVVGDFKGHPEETPLEERKSISIDKDNFEAVMRESN
LNLKTSVSNELDDKGGDIAVDLEFSSLADFSPDSIAAQVPELKKLIELREALVALKGPLGNVAAFRNSLQ
SMLSSDSSREQLLAELNLVNEENADQDQPSE
 
Nucleotide Sequence: 516 bp     [Download]
>ref|NC_015559.1|:c2746085-2745570 type VI secretion lipoprotein [Marinomonas posidonica IVIA-Po-181]
ATGTCAAAAGAAGGAAGCGTCGCTCCTAAAGAGCGAATTAATATTAAATACATACCAGCAACGGGTGATG
CTCAAGCTGAAGTTGAATTGCCATTGAAAACTTTGGTTGTCGGTGATTTTAAAGGCCATCCAGAAGAAAC
GCCTTTAGAAGAACGGAAAAGTATTTCCATTGATAAAGATAACTTCGAAGCGGTAATGCGCGAAAGTAAT
TTGAATCTTAAAACCTCTGTTAGCAACGAGTTGGATGATAAAGGTGGCGATATTGCGGTAGATCTTGAAT
TTTCAAGTCTTGCTGATTTTTCTCCAGATTCCATCGCTGCTCAAGTGCCAGAGCTGAAAAAACTGATTGA
ATTAAGAGAAGCTTTGGTTGCATTAAAAGGGCCTTTAGGGAATGTCGCTGCATTTCGTAATAGCCTTCAA
TCAATGTTGTCATCTGATTCAAGCAGAGAACAGCTGCTTGCAGAACTCAATCTTGTGAATGAAGAAAATG
CTGACCAAGATCAGCCGTCTGAGTAA