SecReT6
Protein ID: 333908863
SecReT6 ID441
T6SS typei1
Gene symbol-
Locus tagMar181_2497
StrainMarinomonas posidonica IVIA-Po-181
Repliconchromosome [GenBank: NC_015559] [Browse all T6SS(s) in this replicon]
Location [Strand]2751230..2753359 [+]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDF6CWW8
KEGG IDmpc:Mar181_2497
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.30E-61, Aligned region: 43..338
Phage_base_V [PF04717], Evalue: 1.20E-22, Aligned region: 377..476
Protein Sequence: 709 a.a.     [Download]
>gi|333908863|ref|YP_004482449.1| ImpA family type VI secretion-associated protein [Marinomonas posidonica IVIA-Po-181]
MATLMFKLAVDGLDENTLLVREYRGQDSLSDSTLDDGTTCYGFRYQLNLASRRMDLSADNIVDKQAELTV
WRDGELVHRVHGIVRHFEKGDTGHNYTFYGLTLVPALERLSLRHNSRIFQKQSAKDILTQLITDMDMPAP
VFTLENEEPKEREFCVQYRETDADFLHRLAAEEGWVYYFSHEAGKHTLHFIDKSQALAVQDDAIAYHLLT
AGVSETPYIKALSEHKQSLPSQSTLKDYSFKQPGYAALNQHTGTNLEHQLSLYEHFDAPGRFKDNATGQR
FARIRLEYLRRRAHLLTGDSDASAILVGRKIRIAGHFDASIQDNSWIPVQVEHHGTQPQVLEEEGGEGQT
SYQNHFTLIPGQVNWQATPQPQPSVDGPMMATVVGPAANDGDTPEEIYCDEHGRVKIQFAWDRYGQKDDF
SSCWVQVSQSWAGSQYGTIALPRIGTDVIVSFLNGDPDQPIITGRTYNADNLPPYALPANKTKTVWRSQT
HQGEGFNEISFEDQVGQEQVYLHAQKDLQTDVLNDQTTSIGNDQHLSVVNDSFSEVKNNQHITVKGERRS
KVTLDQTHIVEGSLQQQVGEIAVTEAGTELHLKTDGNVVLDAGPLFTLKSGDNFITIDENGINVVGAIIK
VNTGGAALEGSGFAGVLPELPIGAELAEPSEASTVEPTPALKQKLLEDQLQDQPVTELCQKQLDNTCPLS
DCPCGNYRA
 
Nucleotide Sequence: 2130 bp     [Download]
>ref|NC_015559.1|:2751230-2753359 ImpA family type VI secretion-associated protein [Marinomonas posidonica IVIA-Po-181]
ATGGCGACGTTAATGTTTAAGCTGGCCGTTGACGGCCTCGATGAGAACACCTTGCTGGTACGAGAGTACC
GAGGCCAAGACTCTCTCTCGGATTCCACATTAGACGATGGAACCACTTGCTATGGGTTCCGTTATCAACT
GAACTTAGCCAGTCGTCGTATGGACTTGTCTGCGGACAACATCGTCGACAAGCAAGCGGAATTAACCGTC
TGGCGTGATGGTGAACTGGTTCACCGAGTGCATGGTATCGTCCGCCACTTTGAAAAAGGCGACACCGGCC
ACAACTACACCTTTTACGGCTTGACCCTAGTGCCCGCGTTAGAGCGACTGTCGTTACGCCATAACAGCCG
CATCTTCCAAAAACAAAGCGCCAAAGACATCCTCACCCAATTGATCACCGACATGGACATGCCGGCCCCC
GTGTTCACCTTGGAAAACGAAGAACCAAAAGAACGGGAGTTCTGCGTTCAATACCGTGAAACCGATGCCG
ACTTCCTACATCGATTGGCCGCCGAAGAAGGCTGGGTCTATTACTTTAGCCACGAAGCAGGCAAACACAC
CTTACACTTCATCGACAAGAGCCAAGCTTTAGCCGTACAAGACGACGCCATTGCCTACCATTTACTCACC
GCTGGGGTCTCCGAAACCCCTTACATCAAAGCGCTCAGTGAACACAAACAATCCCTACCCAGTCAGTCGA
CCTTAAAAGACTACAGCTTCAAGCAACCGGGTTACGCCGCCTTGAATCAGCACACAGGGACCAACCTAGA
ACATCAACTGAGCCTCTACGAACACTTTGATGCCCCAGGCCGTTTTAAAGACAACGCCACTGGCCAACGT
TTTGCCCGCATCCGTTTAGAATACTTGCGCCGTCGTGCTCACCTGTTGACCGGTGATAGCGACGCCTCAG
CGATCCTCGTTGGCCGCAAAATACGCATTGCCGGTCACTTCGACGCCAGCATCCAAGACAACAGCTGGAT
CCCAGTTCAAGTCGAACACCATGGCACCCAACCACAAGTCCTCGAAGAAGAAGGGGGCGAAGGTCAGACC
AGCTACCAAAACCACTTTACCCTGATCCCGGGCCAAGTGAACTGGCAGGCAACCCCACAACCGCAACCCA
GTGTCGATGGCCCCATGATGGCCACCGTCGTCGGTCCAGCGGCCAACGATGGCGATACCCCAGAAGAAAT
CTACTGTGACGAACACGGTCGAGTGAAAATCCAATTTGCTTGGGACCGTTACGGACAAAAAGACGACTTC
AGCTCCTGCTGGGTCCAAGTCTCCCAAAGCTGGGCGGGCAGCCAATACGGCACCATCGCCCTGCCTCGCA
TTGGTACCGACGTCATCGTCAGCTTCCTTAACGGTGACCCAGACCAACCCATTATTACCGGTCGAACCTA
CAACGCTGACAACTTACCGCCTTACGCCTTACCGGCGAACAAAACCAAAACCGTGTGGCGCAGCCAAACC
CACCAAGGGGAGGGGTTTAACGAAATCAGCTTCGAAGACCAAGTGGGCCAAGAACAAGTCTACCTGCACG
CCCAAAAAGACCTGCAAACCGACGTCTTAAATGACCAGACCACCAGCATAGGTAACGACCAACACCTGAG
TGTGGTCAATGACAGCTTCAGTGAAGTGAAAAACAACCAGCACATCACGGTCAAAGGGGAACGTCGAAGC
AAGGTCACCTTAGACCAAACCCACATAGTCGAAGGCAGCTTACAGCAGCAGGTCGGTGAGATCGCCGTGA
CCGAAGCTGGAACAGAATTGCACCTCAAAACGGACGGTAATGTGGTACTGGATGCTGGCCCCCTATTCAC
CCTGAAATCCGGCGATAACTTCATCACCATCGACGAAAACGGCATCAATGTCGTAGGCGCCATTATCAAG
GTCAACACTGGCGGTGCTGCATTAGAAGGCAGCGGTTTTGCAGGGGTGTTGCCCGAATTACCAATCGGCG
CTGAATTAGCGGAGCCGTCAGAAGCCTCCACAGTAGAACCAACGCCAGCGTTAAAACAAAAATTGCTAGA
AGACCAGCTGCAAGATCAACCCGTAACCGAACTGTGTCAGAAGCAGCTTGATAACACCTGCCCTCTTAGC
GATTGTCCTTGTGGGAACTACCGAGCATGA