SecReT6
Protein ID: 333914583
SecReT6 ID442
T6SS typei3
Gene symbol-
Locus tagDelCs14_2953
StrainDelftia sp. Cs1-4
Repliconchromosome [GenBank: NC_015563] [Browse all T6SS(s) in this replicon]
Location [Strand]3328395..3328754 [-]
Producthypothetical protein
NotePAAR
UniProt IDF6AQI5
KEGG IDdel:DelCs14_2953
PDB IDNA
Domain hit(s) vs Pfam DUF4150 [PF13665], Evalue: 1.60E-30, Aligned region: 15..116
PAAR_motif [PF05488], Evalue: 8.20E-05, Aligned region: 40..62
PAAR_motif [PF05488], Evalue: 8.20E-05, Aligned region: 46..112
Protein Sequence: 119 a.a.     [Download]
>gi|333914583|ref|YP_004488315.1| hypothetical protein DelCs14_2953 [Delftia sp. Cs1-4]
MADENIASKDGRFRIVSLTPDVCLTPSKNGVPVPYPITHQMNQSRQCSPNVFLQGKPVYLHNQSYVDNVM
GDEPGQGKGVVSQTNMRISHDIDHSKTVYVNGRAIVRTGDKMWMNWKKP
 
Nucleotide Sequence: 360 bp     [Download]
>ref|NC_015563.1|:c3328754-3328395 hypothetical protein DelCs14_2953 [Delftia sp. Cs1-4]
GTGGCTGACGAAAACATCGCATCCAAGGACGGGCGGTTTCGCATCGTTTCGCTCACCCCAGATGTATGCC
TGACACCAAGCAAGAACGGCGTCCCGGTGCCCTACCCCATCACGCACCAGATGAACCAGAGCAGGCAGTG
CTCTCCCAACGTCTTCCTGCAAGGCAAGCCTGTCTACCTTCACAACCAGAGCTATGTCGACAACGTCATG
GGCGATGAACCCGGACAAGGCAAGGGCGTGGTCAGCCAGACCAATATGCGCATCAGCCACGACATTGACC
ACAGCAAGACCGTCTACGTCAATGGCCGGGCCATCGTGCGCACCGGCGACAAGATGTGGATGAACTGGAA
GAAGCCCTGA