SecReT6
Protein ID: 333914585
SecReT6 ID442
T6SS typei3
Gene symbol-
Locus tagDelCs14_2955
StrainDelftia sp. Cs1-4
Repliconchromosome [GenBank: NC_015563] [Browse all T6SS(s) in this replicon]
Location [Strand]3330074..3332266 [-]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDF6AQI7
KEGG IDdel:DelCs14_2955
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.70E-84, Aligned region: 23..326
Phage_base_V [PF04717], Evalue: 1.30E-27, Aligned region: 91..103
Phage_base_V [PF04717], Evalue: 1.30E-27, Aligned region: 366..459
Phage_base_V [PF04717], Evalue: 1.30E-27, Aligned region: 663..703
Gp5_C [PF06715], Evalue: 0.0002, Aligned region: 519..538
Gp5_C [PF06715], Evalue: 0.0002, Aligned region: 543..556
Gp5_C [PF06715], Evalue: 0.0002, Aligned region: 551..573
Gp5_C [PF06715], Evalue: 0.0002, Aligned region: 566..589
Gp5_C [PF06715], Evalue: 0.0002, Aligned region: 575..597
Gp5_C [PF06715], Evalue: 0.0002, Aligned region: 603..613
Gp5_C [PF06715], Evalue: 0.0002, Aligned region: 599..619
Gp5_C [PF06715], Evalue: 0.0002, Aligned region: 636..653
Gp5_C [PF06715], Evalue: 0.0002, Aligned region: 663..677
Gp5_C [PF06715], Evalue: 0.0002, Aligned region: 697..711
Protein Sequence: 730 a.a.     [Download]
>gi|333914585|ref|YP_004488317.1| ImpA family type VI secretion-associated protein [Delftia sp. Cs1-4]
MTRRVTINTPLADQLQLRRLQGREEISHLFALEIDLLSESDSIDPKALLGKGATVVVETQDGGKRYIDGL
VTAFGMRGQDEHRNFLYRARLSPWLWLATRRSDFRIFQNKTVPDIINEVLGIYGHPMQQRLTRSYRTWEY
CVQYNETDFQFVSRLMEHEGICYYHQHSAGQHVLTLGDDIVASHDPLQGGAVIPFHPPGKAAVAREECIH
AWELHQRVKPGRHYNDDYDFKKPRAELSNMRRNPPGHAHDAYEIYEWPGGYTETGDGEDYIRVRLQQSLT
RQSTVQGSSNHRAMAPGYTFTLDNYPRGDQNQAYLVTAVNYAFEENPRVSDGGSGEGSTQKFVLQAQPTS
LPFKPERITAKPRTTGPQTAVVVGPAGEEIWCDQYGRVKVQFHWDRIGGMNENSSCWMRVATSWAGPGFG
AVHIPRIGMEVIVDFLNGDPDYPIVMGCVYNASNMPPWALPANATQSGIKTRSSKGGAPGAGLKNGQGDA
NAIRFEDKAGAEQLWLHAQKDQLTEVENDEDKWVGNDRRKTVDRDETNVIHRDRTETVDRDETITVHNNR
TERVDHNEKISIGDNRNEDVGIDENISIGKNRSKTIGRNEKDKIGNNWSIKVGSFKTETIGLAYMQNVGL
AKMVNIGAAYNVNVGAAMVVNVGLSQSTTVLVDRSVRVQGNQQTTVGKRYAIQAGDELSITVGAASLVMK
SDGTITINGKNIDVVGSKHIGLDSKRIDLN
 
Nucleotide Sequence: 2193 bp     [Download]
>ref|NC_015563.1|:c3332266-3330074 ImpA family type VI secretion-associated protein [Delftia sp. Cs1-4]
ATGACACGCAGAGTCACCATCAACACCCCCCTGGCAGACCAGCTGCAGCTGCGCCGGCTGCAGGGTCGCG
AGGAAATCAGCCATCTGTTCGCCCTGGAGATCGACCTGCTCAGCGAAAGCGACAGCATCGATCCCAAGGC
CCTGCTGGGCAAGGGCGCCACCGTGGTGGTGGAGACCCAGGACGGCGGCAAACGCTACATCGATGGCCTG
GTCACGGCCTTCGGCATGCGCGGCCAGGACGAGCACCGCAACTTCCTGTACCGCGCGCGCCTGTCGCCCT
GGCTGTGGCTGGCCACGCGCCGCAGCGACTTTCGCATCTTCCAGAACAAGACCGTGCCGGACATCATCAA
CGAAGTCCTGGGCATCTACGGCCACCCCATGCAGCAGCGCCTGACGCGCTCCTACCGCACCTGGGAGTAC
TGCGTGCAGTACAACGAGACGGACTTCCAGTTCGTCTCGCGCCTCATGGAGCACGAGGGCATCTGCTACT
ACCACCAGCACAGCGCGGGCCAGCACGTGCTGACATTGGGCGACGACATCGTCGCCTCGCACGACCCGCT
GCAGGGCGGCGCCGTCATCCCCTTCCACCCGCCCGGCAAGGCCGCCGTGGCGCGCGAGGAATGCATACAC
GCCTGGGAGCTGCACCAGCGCGTCAAGCCCGGCCGGCACTACAACGACGACTACGACTTCAAGAAGCCCC
GCGCCGAGCTGTCCAACATGCGGCGCAACCCGCCCGGCCATGCGCACGACGCCTACGAGATCTACGAATG
GCCGGGCGGCTACACCGAAACCGGCGACGGCGAGGACTACATCCGCGTGCGCCTGCAGCAAAGCCTCACG
CGCCAGAGCACGGTGCAGGGCAGCTCCAACCACCGCGCCATGGCGCCGGGCTACACCTTCACGCTGGACA
ACTACCCGCGCGGCGACCAGAACCAGGCCTACCTGGTCACGGCCGTGAACTACGCCTTCGAAGAAAACCC
GCGCGTCAGCGACGGCGGCAGCGGCGAGGGCTCGACACAGAAATTCGTGCTCCAGGCCCAGCCCACCAGC
CTGCCCTTCAAACCCGAACGCATTACCGCCAAGCCGCGCACCACGGGCCCGCAGACTGCCGTCGTCGTCG
GCCCCGCAGGCGAAGAGATCTGGTGCGACCAGTACGGCCGCGTCAAGGTCCAGTTCCACTGGGACCGCAT
CGGCGGCATGAACGAGAACTCCAGCTGCTGGATGCGCGTGGCCACCAGCTGGGCCGGGCCGGGCTTTGGC
GCGGTGCACATCCCGCGCATCGGCATGGAAGTCATCGTGGACTTCCTCAACGGCGACCCGGACTACCCCA
TCGTCATGGGCTGCGTCTACAACGCCTCCAACATGCCGCCCTGGGCGCTGCCGGCCAACGCCACGCAATC
GGGCATCAAGACAAGATCCAGCAAGGGCGGCGCACCGGGCGCGGGCCTGAAGAACGGCCAGGGCGACGCC
AACGCCATCCGCTTCGAGGACAAGGCGGGCGCCGAACAACTGTGGCTGCATGCGCAAAAGGACCAGCTCA
CCGAAGTCGAGAACGACGAGGACAAATGGGTGGGCAACGACCGGCGCAAGACCGTGGACCGTGACGAGAC
CAACGTCATCCACCGGGACCGCACCGAGACCGTGGACCGCGACGAAACCATCACCGTGCACAACAACCGC
ACGGAGCGGGTGGACCACAACGAGAAGATCAGCATCGGCGACAACCGCAATGAAGACGTCGGCATCGACG
AGAACATCTCCATCGGCAAGAACCGCAGCAAGACCATAGGCCGCAACGAGAAGGACAAGATCGGCAACAA
CTGGTCGATCAAGGTGGGCAGCTTCAAGACAGAGACCATCGGACTGGCCTACATGCAGAACGTGGGCCTG
GCCAAGATGGTGAACATCGGCGCCGCCTACAACGTCAATGTGGGCGCGGCCATGGTGGTGAATGTGGGGC
TGAGCCAGAGCACGACGGTGCTGGTGGACCGTTCCGTCAGGGTCCAGGGCAACCAGCAGACCACGGTAGG
AAAGCGCTACGCCATTCAGGCCGGCGACGAGCTCTCAATCACCGTGGGCGCTGCCAGCTTGGTAATGAAA
AGCGACGGCACGATCACCATCAATGGCAAGAACATCGACGTGGTCGGCAGTAAGCACATCGGCCTCGACT
CCAAGCGTATTGACCTGAACTGA