SecReT6
Protein ID: 333914590
SecReT6 ID442
T6SS typei3
Gene symbol-
Locus tagDelCs14_2960
StrainDelftia sp. Cs1-4
Repliconchromosome [GenBank: NC_015563] [Browse all T6SS(s) in this replicon]
Location [Strand]3337938..3340679 [-]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDF6AQJ2
KEGG IDdel:DelCs14_2960
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.70E-40, Aligned region: 233..254
AAA_2 [PF07724], Evalue: 2.70E-40, Aligned region: 638..805
AAA [PF00004], Evalue: 6.50E-20, Aligned region: 233..346
AAA [PF00004], Evalue: 6.50E-20, Aligned region: 644..728
ClpB_D2-small [PF10431], Evalue: 9.60E-14, Aligned region: 812..885
AAA_5 [PF07728], Evalue: 1.50E-13, Aligned region: 233..255
AAA_5 [PF07728], Evalue: 1.50E-13, Aligned region: 643..762
AAA_16 [PF13191], Evalue: 4.90E-08, Aligned region: 53..75
AAA_16 [PF13191], Evalue: 4.90E-08, Aligned region: 133..154
AAA_16 [PF13191], Evalue: 4.90E-08, Aligned region: 210..255
AAA_16 [PF13191], Evalue: 4.90E-08, Aligned region: 277..312
AAA_16 [PF13191], Evalue: 4.90E-08, Aligned region: 423..483
AAA_16 [PF13191], Evalue: 4.90E-08, Aligned region: 547..565
AAA_16 [PF13191], Evalue: 4.90E-08, Aligned region: 635..688
AAA_16 [PF13191], Evalue: 4.90E-08, Aligned region: 708..730
AAA_16 [PF13191], Evalue: 4.90E-08, Aligned region: 785..831
AAA_25 [PF13481], Evalue: 3.40E-07, Aligned region: 231..305
AAA_25 [PF13481], Evalue: 3.40E-07, Aligned region: 641..670
Sigma54_activat [PF00158], Evalue: 1.20E-06, Aligned region: 229..251
Sigma54_activat [PF00158], Evalue: 1.20E-06, Aligned region: 643..759
AAA_22 [PF13401], Evalue: 1.90E-06, Aligned region: 62..98
AAA_22 [PF13401], Evalue: 1.90E-06, Aligned region: 233..313
AAA_22 [PF13401], Evalue: 1.90E-06, Aligned region: 385..393
AAA_22 [PF13401], Evalue: 1.90E-06, Aligned region: 641..666
AAA_22 [PF13401], Evalue: 1.90E-06, Aligned region: 705..731
NACHT [PF05729], Evalue: 1.30E-05, Aligned region: 233..259
NACHT [PF05729], Evalue: 1.30E-05, Aligned region: 296..335
NACHT [PF05729], Evalue: 1.30E-05, Aligned region: 643..671
Zeta_toxin [PF06414], Evalue: 4.30E-05, Aligned region: 233..255
Zeta_toxin [PF06414], Evalue: 4.30E-05, Aligned region: 401..457
Zeta_toxin [PF06414], Evalue: 4.30E-05, Aligned region: 642..683
AAA_14 [PF13173], Evalue: 0.00013, Aligned region: 235..313
AAA_14 [PF13173], Evalue: 0.00013, Aligned region: 642..760
AAA_17 [PF13207], Evalue: 0.00017, Aligned region: 233..274
AAA_17 [PF13207], Evalue: 0.00017, Aligned region: 643..679
IstB_IS21 [PF01695], Evalue: 0.00019, Aligned region: 224..252
IstB_IS21 [PF01695], Evalue: 0.00019, Aligned region: 643..663
IstB_IS21 [PF01695], Evalue: 0.00019, Aligned region: 753..777
AAA_18 [PF13238], Evalue: 0.0011, Aligned region: 233..253
AAA_18 [PF13238], Evalue: 0.0011, Aligned region: 644..672
AAA_18 [PF13238], Evalue: 0.0011, Aligned region: 835..875
AAA_19 [PF13245], Evalue: 0.0016, Aligned region: 230..256
AAA_19 [PF13245], Evalue: 0.0016, Aligned region: 434..449
AAA_19 [PF13245], Evalue: 0.0016, Aligned region: 525..543
AAA_19 [PF13245], Evalue: 0.0016, Aligned region: 641..665
AAA_29 [PF13555], Evalue: 0.0046, Aligned region: 225..249
AAA_29 [PF13555], Evalue: 0.0046, Aligned region: 641..655
Clp_N [PF02861], Evalue: 0.0051, Aligned region: 29..75
Clp_N [PF02861], Evalue: 0.0051, Aligned region: 107..128
RuvB_N [PF05496], Evalue: 0.0069, Aligned region: 233..248
RuvB_N [PF05496], Evalue: 0.0069, Aligned region: 302..313
RuvB_N [PF05496], Evalue: 0.0069, Aligned region: 610..664
RuvB_N [PF05496], Evalue: 0.0069, Aligned region: 712..736
RNA_helicase [PF00910], Evalue: 0.0081, Aligned region: 234..254
RNA_helicase [PF00910], Evalue: 0.0081, Aligned region: 644..665
RNA_helicase [PF00910], Evalue: 0.0081, Aligned region: 742..762
TIP49 [PF06068], Evalue: 0.0099, Aligned region: 233..255
TIP49 [PF06068], Evalue: 0.0099, Aligned region: 284..313
TIP49 [PF06068], Evalue: 0.0099, Aligned region: 642..679
Protein Sequence: 913 a.a.     [Download]
>gi|333914590|ref|YP_004488322.1| type VI secretion ATPase, ClpV1 family [Delftia sp. Cs1-4]
MTEISRQSLFGKLNPLLFKSLEGATVFCKLRGNPYVELVHWLHQLLQENDCDLIRILRHFDIASDRLAAD
VLRRLDQLPRGATSISDFSEHIETAIERGWVYATLMFNDSQIRSAYLLSGMVRTRSLANELRSISREFDK
ISEPALSDAFARLLPDSPEARMRAADGSGLEGTPGEASQATGAAPGQGGALQQYTVDLTARAKAGELDPV
TGRDDEVRQMVDILLRRRQNNPILVGEAGVGKTAVVEGLALRIAQGDVPPPLQGVELRVLDVGLLQAGAS
MKGEFENRLRGLLDAVQSSTTPIVLFIDEVHTLVGAGGQAGTGDAANLLKPALARGTLRTIGATTWAEYK
KYIEKDPALTRRFQLVQVHEPDEPRAVDMLRGVAAKLENHHQVRIAADAVAAAVSLSHRYIPSRQLPDKA
VSLLDTACSRVAMALHATPAQLEAVQRRIEALGVEQEVLLREAALGLPTAERLQALETDLASLRDRQATL
AERFGQESALARRILETEAALMGLKPPVFSTGAAAAPSAAAQETAAEATATEPAEPPSVAALEALRRQLA
ELQGDAPLLQPVVDAGVVAAVVAEWTGIPVGRMVRDEVQSVLSLADTLEKRVIGQRHGLEAITRRIQTSR
ARLDDPGKPIGVFLLAGPSGVGKTETALSLAEALYGGEQNLITINMSEFQEAHTVSTLKGAPPGYVGYGE
GGVLTEAVRRRPYSVVLLDEIEKAHSDVHEMFFQVFDKGWMEDGEGRYIDFKNTVIILTSNVGSDLIANM
CRDPDLAPTPEGLAQAVRQPLLQTFPAALLGRLTVVPYYPISDAMLEQIIRLQMLRIQRRIEERHGAQFS
FDEAAVDLVRRRCSEVESGARMVDGILTQNLLPRMATHFLQATVEGQELQSLHAGASGDDFTLDVRTRAA
EPA
 
Nucleotide Sequence: 2742 bp     [Download]
>ref|NC_015563.1|:c3340679-3337938 type VI secretion ATPase, ClpV1 family [Delftia sp. Cs1-4]
ATGACAGAAATCAGCCGCCAATCCCTCTTCGGCAAGCTCAACCCGCTGCTGTTCAAGTCGCTGGAAGGCG
CCACCGTGTTCTGCAAGCTGCGCGGCAATCCCTATGTGGAGCTGGTGCACTGGCTGCACCAGCTGCTGCA
GGAAAACGATTGCGACCTGATCCGCATCCTGCGCCACTTCGACATCGCCTCCGACCGCCTGGCCGCCGAT
GTGCTGCGCCGTCTGGACCAGCTGCCCCGCGGCGCCACCTCGATCAGCGACTTCTCCGAGCACATAGAGA
CCGCCATCGAGCGCGGCTGGGTCTATGCCACGCTCATGTTCAACGACAGCCAGATCCGCAGCGCCTATCT
GCTGTCGGGCATGGTGCGCACGCGCTCGCTGGCCAATGAGCTGCGCTCCATCTCGCGCGAATTCGACAAG
ATCTCCGAGCCCGCGCTCAGCGATGCCTTCGCCCGCCTGCTGCCCGACTCGCCCGAGGCACGCATGCGCG
CGGCCGATGGCAGCGGGCTCGAAGGCACGCCGGGCGAAGCCAGCCAGGCCACGGGCGCCGCGCCCGGCCA
GGGCGGTGCGCTGCAGCAGTACACGGTGGACCTGACGGCCCGCGCCAAGGCCGGCGAACTGGACCCGGTC
ACGGGCCGCGACGACGAAGTGCGCCAGATGGTGGACATCCTGCTGCGCCGCCGCCAGAACAACCCCATCC
TGGTTGGCGAGGCCGGCGTGGGCAAAACCGCCGTGGTCGAAGGCCTGGCCCTGCGCATCGCCCAGGGCGA
CGTGCCGCCGCCGCTGCAGGGCGTGGAGCTGCGCGTGCTGGACGTGGGCCTGCTGCAGGCCGGCGCCAGC
ATGAAGGGCGAGTTCGAGAACCGCCTGCGCGGCCTGCTGGACGCCGTGCAGTCCAGCACCACGCCCATCG
TGCTCTTCATCGACGAAGTCCACACCCTGGTGGGCGCGGGCGGCCAGGCCGGCACGGGCGATGCCGCCAA
CCTGCTCAAGCCCGCCCTGGCGCGCGGCACGCTGCGCACCATCGGCGCCACCACCTGGGCCGAGTACAAG
AAATACATCGAAAAAGACCCGGCCCTGACCCGCCGCTTCCAGCTCGTTCAGGTGCACGAGCCCGACGAGC
CCCGCGCCGTGGACATGCTGCGCGGCGTGGCCGCCAAGCTGGAAAACCACCATCAGGTGCGCATTGCCGC
AGACGCGGTGGCCGCGGCCGTCAGCCTGTCGCACCGCTACATTCCCTCGCGCCAGCTGCCCGACAAGGCC
GTCAGCCTGCTGGACACGGCCTGCTCGCGCGTGGCCATGGCCCTGCATGCCACGCCCGCCCAGCTTGAAG
CCGTGCAGCGCCGCATCGAGGCCCTGGGCGTGGAGCAGGAAGTGCTGCTGCGCGAGGCAGCCCTCGGCCT
GCCCACGGCCGAGCGCCTGCAGGCGCTGGAAACCGACCTGGCCAGCCTGCGCGACCGCCAGGCCACGCTG
GCCGAGCGCTTCGGCCAGGAAAGCGCGCTGGCGCGCCGCATCCTGGAAACCGAGGCCGCCCTCATGGGCC
TGAAGCCGCCCGTCTTCTCCACCGGCGCCGCCGCAGCCCCGTCCGCTGCGGCACAGGAAACGGCCGCCGA
AGCCACCGCAACCGAACCTGCCGAGCCCCCCAGCGTGGCCGCGCTGGAAGCGCTGCGCCGCCAGCTCGCC
GAGCTGCAGGGCGATGCCCCGCTGCTGCAGCCCGTGGTCGATGCCGGCGTGGTCGCCGCCGTCGTGGCCG
AGTGGACCGGCATTCCCGTGGGCCGCATGGTGCGCGACGAGGTGCAGTCCGTGCTCTCGCTGGCAGACAC
GCTGGAGAAGCGCGTCATCGGCCAGCGCCATGGCCTGGAGGCCATCACGCGCCGCATCCAGACATCGCGC
GCGCGGCTGGACGACCCGGGCAAGCCCATCGGCGTGTTCCTGCTGGCCGGTCCCTCGGGCGTGGGCAAGA
CCGAGACGGCGCTGTCCCTGGCCGAAGCCCTGTATGGCGGCGAGCAAAACCTCATCACCATCAACATGAG
CGAGTTCCAAGAGGCGCACACCGTCTCCACCCTCAAGGGCGCGCCACCGGGCTACGTGGGCTACGGCGAA
GGCGGCGTGCTCACCGAGGCCGTGCGCCGCCGCCCCTACAGCGTGGTTCTGCTCGACGAAATCGAAAAGG
CCCACTCCGACGTGCACGAGATGTTCTTCCAGGTCTTCGACAAGGGCTGGATGGAAGACGGCGAGGGCCG
CTACATCGACTTCAAGAACACCGTCATCATCCTGACCTCCAACGTGGGCTCGGACCTGATCGCCAACATG
TGCCGCGACCCGGACCTGGCGCCCACGCCGGAAGGCCTGGCCCAGGCCGTGCGCCAGCCGCTGCTGCAGA
CCTTTCCCGCCGCGCTGCTGGGCCGCCTGACGGTGGTGCCCTACTACCCCATCTCCGACGCCATGCTGGA
GCAGATCATCCGGCTGCAGATGCTGCGCATACAGCGGCGCATCGAAGAGCGCCACGGCGCGCAGTTCAGC
TTCGACGAAGCCGCCGTGGACTTGGTGCGCCGCCGCTGCAGCGAGGTCGAGTCCGGTGCGCGCATGGTGG
ACGGCATCCTCACCCAGAACCTGCTGCCGCGCATGGCCACCCACTTCCTGCAGGCCACCGTGGAAGGCCA
GGAACTGCAAAGCCTGCACGCCGGCGCCAGCGGCGACGACTTCACGCTGGACGTGCGCACCCGCGCTGCG
GAGCCCGCATGA