SecReT6
Protein ID: 333914594
SecReT6 ID442
T6SS typei3
Gene symbol-
Locus tagDelCs14_2964
StrainDelftia sp. Cs1-4
Repliconchromosome [GenBank: NC_015563] [Browse all T6SS(s) in this replicon]
Location [Strand]3342788..3343978 [-]
Producttype VI secretion lipoprotein
NoteTssG
UniProt IDF6AQJ6
KEGG IDdel:DelCs14_2964
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 9.90E-112, Aligned region: 50..353
Protein Sequence: 396 a.a.     [Download]
>gi|333914594|ref|YP_004488326.1| type VI secretion lipoprotein [Delftia sp. Cs1-4]
MSNAAHAPLPEPEHLQSAAPAQAPAPARAPVQAAGPDDARARLFWQRLSAKPYQFDLMHSLRYLQARHPA
LPRLGQATRPKDEPLRLGQDPSLAFAPATIAEILPSRAGEPERMTVWNFGLYGPNGPLPTHITEYVRERL
RQHDDATLARFSDIFHHRMLLLLFRAWSDAQPTASLDRPGEDPFGRYIDSFIGAGLPSQRARDDVPDHAK
RFMAGHLTRWTRNPEGLCQALSHYFQIPVKLEENCLHHLELEPEQQTRLQGRPCNSRLGVDAVVGSRVPD
AQSKFRLVLGPLGLEQYRQLLPQAALFQTLVDWVRNYLGIEFAWDYVLVLRRQEVPAARLGSSTQLGWTT
WLTHAEPAQDARDFRLDPEAWLRQRRQPVRGRRPGPSPRTTESPNH
 
Nucleotide Sequence: 1191 bp     [Download]
>ref|NC_015563.1|:c3343978-3342788 type VI secretion lipoprotein [Delftia sp. Cs1-4]
ATGAGCAATGCCGCCCACGCCCCCCTGCCCGAACCGGAACACCTCCAGTCTGCGGCTCCGGCTCAAGCTC
CGGCGCCCGCGCGTGCGCCCGTGCAGGCCGCCGGGCCCGACGACGCCCGGGCGCGCCTGTTCTGGCAGCG
CCTGAGCGCCAAGCCCTACCAGTTCGACCTGATGCACAGCCTGCGCTACCTGCAGGCGCGCCATCCCGCG
CTGCCGCGCCTGGGCCAGGCCACGCGCCCCAAGGACGAGCCGCTGCGCCTGGGCCAGGACCCGTCGCTGG
CCTTCGCCCCCGCCACCATTGCCGAAATCCTGCCCTCGCGCGCCGGCGAGCCCGAGCGCATGACGGTCTG
GAACTTTGGCCTCTACGGCCCCAACGGTCCGCTGCCCACGCACATCACCGAATACGTGCGCGAGCGCCTG
CGCCAGCATGACGACGCCACGCTGGCACGCTTTTCCGACATCTTTCACCACCGCATGCTGCTGCTGCTGT
TCCGCGCTTGGTCGGACGCACAGCCCACCGCATCGCTGGACCGCCCGGGCGAAGACCCCTTTGGCCGCTA
CATAGACAGTTTCATAGGCGCCGGCCTGCCCAGCCAGCGCGCGCGCGACGACGTGCCAGACCACGCCAAG
CGCTTCATGGCCGGCCATCTGACCCGCTGGACGCGCAACCCCGAAGGACTGTGCCAGGCCCTGTCGCACT
ACTTCCAGATTCCCGTGAAGCTGGAAGAAAACTGCCTGCACCACCTGGAGCTGGAGCCCGAGCAGCAGAC
CCGGCTGCAGGGCCGCCCCTGCAACTCGCGCCTGGGCGTGGACGCCGTCGTGGGCTCGCGCGTGCCCGAT
GCGCAAAGCAAGTTCCGCCTGGTGCTCGGCCCGCTGGGTCTGGAGCAATACCGGCAGCTGCTGCCCCAGG
CCGCACTGTTCCAGACCCTGGTGGACTGGGTGCGCAACTACCTGGGCATCGAATTCGCCTGGGACTACGT
GCTGGTGCTGCGCCGCCAGGAAGTGCCTGCCGCCCGGCTGGGCAGCAGCACCCAGCTGGGCTGGACCACC
TGGCTCACCCACGCCGAGCCCGCCCAGGACGCGCGCGACTTCCGCCTGGACCCCGAAGCCTGGCTGCGCC
AGCGCCGCCAGCCCGTGCGGGGCCGGCGCCCCGGCCCCAGCCCTCGAACCACTGAATCACCGAACCACTG
A