SecReT6
Protein ID: 333914595
SecReT6 ID442
T6SS typei3
Gene symbol-
Locus tagDelCs14_2965
StrainDelftia sp. Cs1-4
Repliconchromosome [GenBank: NC_015563] [Browse all T6SS(s) in this replicon]
Location [Strand]3343975..3345849 [-]
Producttype VI secretion lipoprotein
NoteTssF
UniProt IDF6AQJ7
KEGG IDdel:DelCs14_2965
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.70E-204, Aligned region: 6..622
Protein Sequence: 624 a.a.     [Download]
>gi|333914595|ref|YP_004488327.1| type VI secretion lipoprotein [Delftia sp. Cs1-4]
MNPRLVEYYNRELAYLRELGAEFAAAFPKVAGRLSLHDTDVADPYVERLLEGFSFLSARIQLKMDAEFPR
LSQRMMEMVCPHYLAPTPSMVVVQLKPSAKEGNLVDGFTLPSGSVLRTHKSQEEQTICEFRTGGPLTLWP
LEIRQARLGGPALDLPHALVPQLGEAGGHLRLQLATLDASQCMQLAMDQLWVYIHAGDVVASHLQELIHT
QTLAIVVHHPQDPRQVWDVLQPDALRAEGHDSEQALIPYSHRAFQGHRLLHEYFAFPARQRFFSINGLSR
SMRRIAHDGVGITVLLRRAAPTLEPQIDAAKLLMHCIPAINLFEYTADRLHVASNVHEYHVIPDRTRPLD
FEVYGVQAVTGHHEGKTQDREFAPLYASTHGLHSTEQAYFTTRREPRLFSERSLRSGPRTQYLGSEVFIS
LVDQREAPFSDDLKQLSMHTLCTNRDLPLLMRVNQPGGDFALQESAPVEWARAIAGPSAPIPAVADGGLT
WRLISHLSLNYLAMTDLSDEEGAATLQELLRLYLDLGNHQLAGQIAAIQGMRIEPITRRLPQHRQLVYGR
GVGVHLSVDEPAMAGVSPWPLSNVLERFFARHVGVNSFTELQLHSRQRGPVARWTPRPGQRPGI
 
Nucleotide Sequence: 1875 bp     [Download]
>ref|NC_015563.1|:c3345849-3343975 type VI secretion lipoprotein [Delftia sp. Cs1-4]
ATGAATCCCCGCCTCGTCGAGTACTACAACCGCGAACTGGCCTATCTGCGCGAGCTGGGCGCCGAGTTCG
CCGCCGCCTTCCCCAAGGTGGCGGGCCGCCTTTCCCTGCACGACACCGATGTGGCCGACCCCTATGTGGA
GCGCCTGCTGGAAGGCTTCAGCTTTCTGAGCGCGCGCATCCAGCTGAAGATGGATGCGGAGTTTCCGCGC
CTGTCCCAGCGCATGATGGAAATGGTCTGCCCCCACTACCTGGCGCCCACGCCATCCATGGTGGTGGTCC
AGCTCAAGCCCAGCGCCAAGGAAGGCAACCTCGTGGACGGCTTCACCCTGCCCTCTGGCAGCGTGCTGCG
CACCCACAAGTCACAGGAAGAGCAGACCATCTGCGAATTCCGCACCGGCGGGCCGCTGACGCTGTGGCCG
CTGGAGATACGCCAGGCGCGCCTGGGCGGCCCGGCGCTGGACCTGCCCCATGCGCTGGTGCCCCAGCTGG
GCGAGGCCGGCGGCCACCTGCGCCTGCAGCTGGCCACGCTGGACGCCTCGCAGTGCATGCAGCTGGCGAT
GGACCAGCTGTGGGTCTACATCCATGCGGGCGATGTCGTCGCCTCCCACCTGCAGGAGCTCATCCACACG
CAGACGCTGGCCATCGTGGTCCACCACCCGCAGGACCCGCGCCAGGTCTGGGACGTGCTGCAGCCCGATG
CACTGCGCGCCGAAGGCCATGACAGCGAGCAGGCGCTGATTCCCTATTCGCACCGCGCCTTCCAGGGCCA
CCGTCTGCTGCACGAGTACTTTGCGTTTCCCGCACGGCAGCGGTTCTTCTCGATCAACGGCCTGTCGCGC
AGCATGCGCCGCATTGCCCATGACGGCGTGGGCATCACCGTGCTGCTGCGCCGCGCCGCGCCCACGCTGG
AGCCGCAGATCGACGCGGCCAAGCTGCTGATGCACTGCATTCCGGCCATCAACCTGTTCGAGTACACGGC
GGACCGCCTGCATGTGGCCTCCAACGTGCACGAGTACCACGTCATCCCCGACCGCACGCGGCCGCTGGAC
TTCGAGGTCTACGGCGTGCAGGCAGTCACCGGCCACCACGAAGGCAAGACCCAGGACCGCGAATTCGCGC
CGCTGTACGCATCCACGCACGGCCTGCACTCCACCGAGCAGGCCTACTTCACCACGCGGCGCGAGCCCCG
GCTGTTTTCCGAGCGCAGCCTGCGCAGCGGCCCGCGCACGCAGTACCTGGGCTCGGAAGTCTTCATCTCC
CTGGTGGACCAGCGCGAGGCCCCGTTCTCCGACGACCTCAAGCAGCTGTCCATGCACACCCTGTGCACCA
ACCGCGACCTGCCCCTGCTCATGCGCGTCAACCAGCCGGGCGGCGACTTTGCGCTGCAGGAATCGGCGCC
CGTGGAATGGGCCCGCGCCATCGCCGGCCCCAGCGCGCCCATCCCCGCCGTGGCCGACGGAGGCCTGACC
TGGCGATTGATCTCCCACCTGAGCCTGAACTACCTGGCCATGACCGATCTGTCCGACGAGGAAGGCGCGG
CCACGCTGCAGGAGCTGCTGCGCCTGTACCTGGACCTGGGCAACCACCAGCTGGCCGGGCAGATCGCCGC
CATCCAGGGCATGCGCATCGAACCCATCACGCGCCGCCTGCCCCAGCACCGCCAGCTGGTCTACGGCCGC
GGCGTGGGCGTACACCTGAGCGTGGACGAGCCGGCCATGGCCGGCGTCAGCCCCTGGCCCCTGTCGAATG
TGCTGGAGCGATTCTTCGCCCGCCATGTGGGCGTCAACAGCTTCACCGAGCTGCAGCTGCACTCGCGCCA
GCGCGGCCCCGTCGCGCGCTGGACTCCGCGCCCCGGACAAAGGCCCGGCATATGA