SecReT6
Protein ID: 333914596
SecReT6 ID442
T6SS typei3
Gene symbol-
Locus tagDelCs14_2966
StrainDelftia sp. Cs1-4
Repliconchromosome [GenBank: NC_015563] [Browse all T6SS(s) in this replicon]
Location [Strand]3345873..3346427 [-]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDF6AQJ8
KEGG IDdel:DelCs14_2966
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.20E-21, Aligned region: 10..44
GPW_gp25 [PF04965], Evalue: 1.20E-21, Aligned region: 52..162
Protein Sequence: 184 a.a.     [Download]
>gi|333914596|ref|YP_004488328.1| type VI secretion system lysozyme-like protein [Delftia sp. Cs1-4]
MRPSPLNPMPTLRTRQNQATAAKDRLQPALLDRLTDHEPHLRTERPDAVFVNESRLREALLRDLGWLLNA
RDAWDHVEMEGLEHVQRSVINYGMPPLAGQLLSELDWSHVERSIRESILAFEPRILPKTLAVTLLASTEQ
LNHHNTLQFEIRCQFWSMPYPLELLLKTSLDLETGQVSLQNLRA
 
Nucleotide Sequence: 555 bp     [Download]
>ref|NC_015563.1|:c3346427-3345873 type VI secretion system lysozyme-like protein [Delftia sp. Cs1-4]
ATGCGCCCCAGTCCCCTCAACCCCATGCCCACGCTGCGCACGCGCCAGAACCAGGCGACCGCAGCCAAGG
ACCGGCTGCAGCCCGCCCTGCTGGACCGGCTGACCGACCATGAGCCCCATCTGCGCACCGAGCGGCCCGA
TGCGGTCTTCGTGAACGAATCCCGCCTGCGCGAGGCCCTGCTGCGCGACCTGGGCTGGCTGCTCAATGCG
CGCGATGCCTGGGACCACGTGGAGATGGAGGGGCTGGAGCATGTGCAGCGCTCGGTCATCAACTACGGCA
TGCCGCCGCTGGCCGGCCAGCTGCTTTCCGAGCTGGACTGGAGCCATGTGGAGCGCAGCATCCGCGAAAG
CATCCTGGCCTTCGAGCCGCGCATCCTGCCCAAGACTCTGGCCGTGACGCTGCTGGCCTCCACCGAGCAG
CTCAACCACCACAACACGCTGCAGTTCGAGATCCGCTGCCAGTTCTGGTCCATGCCCTATCCGCTGGAGC
TGCTGCTCAAGACCAGCCTGGACCTGGAGACCGGCCAGGTCTCGCTGCAAAACCTCAGGGCCTGA