SecReT6
Protein ID: 333914599
SecReT6 ID442
T6SS typei3
Gene symbol-
Locus tagDelCs14_2969
StrainDelftia sp. Cs1-4
Repliconchromosome [GenBank: NC_015563] [Browse all T6SS(s) in this replicon]
Location [Strand]3347965..3348771 [-]
Productvirulence protein SciE type
NoteTagJ
UniProt IDF6AQK1
KEGG IDdel:DelCs14_2969
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 2.10E-42, Aligned region: 135..263
Protein Sequence: 268 a.a.     [Download]
>gi|333914599|ref|YP_004488331.1| virulence protein SciE type [Delftia sp. Cs1-4]
MPLPSFTSQLSLDEQLKALKDQIRQAPASAPLRVYYFQLLCVLGEWQKALEQLQLCAQLDPSCEPMARAY
REAIRCEVLRAEVFAGKKKPFLMGEPAQWLACLIDALAHEGAAAQDLRARALDEAPATAGHMGEHRFEWL
ADSDTRLGPVCELLAHGSYYWLPFDAIAQIGFEPVQDLRDLIWLPCEVTLREGGALQGFMPARYPLAPGD
DDAVRMSRRTQWSPLDTDASDPDESSGHVAGHGQRTWVTDSEDFPMLQVRQLTLSTAA
 
Nucleotide Sequence: 807 bp     [Download]
>ref|NC_015563.1|:c3348771-3347965 virulence protein SciE type [Delftia sp. Cs1-4]
ATGCCCCTACCCAGCTTCACCTCACAGCTTTCCCTGGACGAGCAACTCAAGGCCCTGAAGGACCAGATCC
GCCAGGCCCCGGCCTCGGCGCCCCTGCGCGTCTACTACTTCCAGCTGCTGTGCGTGCTGGGCGAATGGCA
AAAGGCGCTGGAGCAGTTGCAGCTGTGCGCCCAGCTCGACCCGTCGTGCGAGCCCATGGCGCGCGCCTAC
CGCGAGGCCATCCGCTGCGAAGTGCTGCGCGCCGAGGTCTTCGCCGGCAAGAAAAAGCCCTTTCTCATGG
GCGAGCCCGCGCAATGGCTGGCCTGCCTGATCGACGCCCTGGCCCATGAAGGAGCAGCTGCCCAGGACCT
GCGCGCCCGCGCCCTGGACGAGGCGCCCGCCACCGCAGGCCACATGGGCGAGCACCGCTTCGAATGGCTG
GCCGACAGCGATACCCGCCTCGGCCCCGTCTGCGAGCTGCTGGCCCACGGCAGCTACTACTGGCTGCCCT
TCGACGCCATTGCACAGATCGGCTTCGAGCCCGTGCAGGACCTGCGCGACCTGATCTGGCTGCCCTGCGA
GGTCACGCTGCGCGAGGGCGGCGCGCTGCAGGGCTTCATGCCTGCGCGCTATCCGCTGGCGCCCGGCGAT
GACGACGCCGTCCGCATGTCGCGCCGCACGCAGTGGAGCCCGCTGGACACAGATGCCTCCGATCCTGACG
AATCCTCGGGCCACGTCGCCGGCCACGGCCAGCGCACCTGGGTCACCGACTCCGAGGACTTTCCCATGCT
GCAGGTGCGCCAGCTCACGCTGAGCACCGCTGCCTGA