SecReT6
Protein ID: 333914602
SecReT6 ID442
T6SS typei3
Gene symbol-
Locus tagDelCs14_2972
StrainDelftia sp. Cs1-4
Repliconchromosome [GenBank: NC_015563] [Browse all T6SS(s) in this replicon]
Location [Strand]3349881..3351374 [-]
Producttype VI secretion lipoprotein
NoteTssC
UniProt IDF6AQK4
KEGG IDdel:DelCs14_2972
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.40E-196, Aligned region: 65..490
Protein Sequence: 497 a.a.     [Download]
>gi|333914602|ref|YP_004488334.1| type VI secretion lipoprotein [Delftia sp. Cs1-4]
MNTATQLEQSTQALAGSEFGSLLQKEFKPKTDQAREAVEAAVQTLAQQALGSAITLSNDAYQTVQAIIAE
IDRKLSEQINRIIHHDDYQKLEGAWRGLHHLVTNTEVDEMLKIRVMNISKKELHRNMRRFKGVGWDQSPV
FKKVYEEEYGQFGGEPFGCLVGDYHFDHSPPDVELLGEMAKVAAAAHCPFISGAAPAIMQMESWQELANP
RDLTKIFTNTEYAAWRSLRESDDAKYIGLAMPRFLARLPYGARTNPVDEFDFEEETDSGDHGKYCWANSA
YAMAVNINRSFKYYGWCTSIRGVESGGAVDNLPAHTFPTDDGGVDMKCPTEIAISDRREAELAKNGFMPL
VHRKNSDVAAFIGAQSLAKPAEYYDSDATANANLSARLPYMFACCRFAHYLKCIVRDKIGSFRERTDMER
WLNDWIMNYVDGDPANSSQETKARKPLAAAEVQVQEVEGNPGYYTSKFFLRPHYQLEGLTVSLRLVSKLP
SVKQGAK
 
Nucleotide Sequence: 1494 bp     [Download]
>ref|NC_015563.1|:c3351374-3349881 type VI secretion lipoprotein [Delftia sp. Cs1-4]
ATGAATACCGCAACCCAACTCGAACAATCGACCCAGGCGCTGGCCGGCAGCGAATTCGGCAGCCTGCTGC
AAAAGGAATTCAAGCCCAAGACCGACCAGGCCCGCGAAGCCGTGGAAGCGGCCGTGCAGACGCTGGCCCA
GCAGGCCCTGGGCTCGGCGATCACGCTGTCCAACGATGCCTACCAGACGGTGCAGGCCATCATTGCCGAG
ATCGACCGCAAGCTGTCCGAGCAGATCAACCGCATCATCCACCACGACGACTACCAGAAGCTCGAAGGCG
CCTGGCGCGGTCTGCACCACCTGGTGACCAACACCGAGGTGGACGAGATGCTCAAGATCCGCGTCATGAA
CATCTCCAAGAAGGAGCTGCACCGCAATATGCGCCGCTTCAAGGGCGTGGGCTGGGACCAGAGCCCCGTC
TTCAAGAAGGTGTACGAAGAGGAGTACGGCCAGTTCGGCGGCGAGCCCTTCGGCTGCCTGGTGGGCGACT
ACCACTTCGACCACAGCCCGCCGGACGTGGAGCTGCTCGGTGAAATGGCCAAGGTGGCCGCCGCGGCGCA
CTGCCCCTTCATCTCGGGCGCGGCGCCCGCCATCATGCAGATGGAATCCTGGCAGGAGCTGGCCAACCCG
CGCGACCTGACCAAGATCTTCACCAACACCGAGTACGCCGCCTGGCGCAGCCTGCGCGAGTCCGATGACG
CCAAGTACATCGGCCTGGCCATGCCCCGCTTCCTGGCACGCCTGCCCTACGGCGCGCGCACCAACCCGGT
CGATGAATTCGACTTCGAGGAAGAAACCGACAGCGGCGACCACGGCAAGTACTGCTGGGCCAACTCGGCC
TACGCCATGGCGGTCAACATCAACCGCTCGTTCAAGTACTACGGCTGGTGCACCTCCATCCGCGGCGTGG
AATCGGGCGGCGCGGTGGACAACCTGCCGGCCCACACCTTCCCCACCGACGATGGCGGCGTGGACATGAA
GTGCCCCACGGAAATCGCCATCAGCGACCGCCGCGAGGCCGAGCTCGCCAAGAACGGCTTCATGCCCCTG
GTGCACCGCAAGAACTCGGACGTGGCCGCCTTCATCGGCGCCCAGTCGCTGGCCAAGCCCGCCGAGTACT
ACGACTCCGACGCCACGGCCAATGCCAACCTGTCGGCGCGCCTGCCCTACATGTTCGCCTGCTGCCGCTT
CGCGCACTACCTCAAGTGCATCGTGCGCGACAAGATCGGCTCCTTCCGCGAGCGCACCGACATGGAGCGC
TGGCTCAACGACTGGATCATGAATTACGTGGACGGCGACCCGGCCAACTCCTCGCAGGAGACCAAGGCCC
GCAAGCCCCTGGCCGCCGCCGAGGTGCAGGTGCAGGAAGTCGAGGGCAACCCCGGCTACTACACCTCCAA
GTTCTTCCTGCGCCCCCACTACCAGCTGGAAGGCCTGACCGTGTCGCTGCGCCTGGTGTCCAAGCTGCCT
TCCGTGAAGCAGGGCGCGAAGTAA