SecReT6
Protein ID: 333914603
SecReT6 ID442
T6SS typei3
Gene symbol-
Locus tagDelCs14_2973
StrainDelftia sp. Cs1-4
Repliconchromosome [GenBank: NC_015563] [Browse all T6SS(s) in this replicon]
Location [Strand]3351403..3351945 [-]
Producttype VI secretion lipoprotein
NoteTssB
UniProt IDF6AQK5
KEGG IDdel:DelCs14_2973
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 7.40E-60, Aligned region: 14..166
Protein Sequence: 180 a.a.     [Download]
>gi|333914603|ref|YP_004488335.1| type VI secretion lipoprotein [Delftia sp. Cs1-4]
MSLTKTGKSGQKFIARNRAPRVQIEYDVEIYGSEKKVQIPFVMGVLADLSGKPVDPLPEIADRKFLEIDI
DNFDARMKSIKPRVAFQVDNTLTGEGKLNIDLSFESMEDFSPAAIARRVGALNSLLEARTQLHNLLSYMD
GKQGAEELIGKVLKDPALLKSLAAAPNITAPQALGPASEA
 
Nucleotide Sequence: 543 bp     [Download]
>ref|NC_015563.1|:c3351945-3351403 type VI secretion lipoprotein [Delftia sp. Cs1-4]
ATGTCGCTCACCAAAACCGGCAAGAGTGGTCAGAAATTCATCGCGCGCAACCGTGCGCCGCGCGTGCAGA
TCGAGTACGACGTCGAGATCTACGGTTCGGAAAAGAAGGTGCAGATCCCCTTCGTGATGGGCGTGCTGGC
CGATCTGTCGGGCAAGCCCGTCGATCCGCTGCCCGAAATCGCCGACCGCAAGTTCCTGGAAATCGACATC
GACAACTTCGATGCGCGCATGAAGTCCATCAAGCCCCGCGTCGCCTTCCAGGTGGACAACACGCTGACGG
GCGAGGGCAAGCTCAACATCGACCTGAGCTTCGAGAGCATGGAGGACTTCTCCCCCGCCGCCATCGCGCG
GCGCGTGGGCGCGCTCAACTCGCTGCTGGAGGCCCGCACCCAGCTGCACAACCTGCTTTCCTACATGGAC
GGCAAGCAGGGCGCCGAGGAGCTGATCGGCAAGGTGCTCAAGGACCCTGCGCTGCTCAAGTCGCTGGCCG
CCGCGCCCAACATCACTGCCCCGCAGGCCTTGGGCCCTGCATCCGAGGCTTGA